Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate GFF3769 PGA1_262p01730 putative glutathione import ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__Phaeo:GFF3769 Length = 325 Score = 278 bits (712), Expect = 1e-79 Identities = 148/322 (45%), Positives = 203/322 (63%), Gaps = 5/322 (1%) Query: 3 ELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNG 62 +LL +++L V++ G +KA+ IS+ +NKGE +GIVGESG GKS + ++LRLI N Sbjct: 4 KLLEIDDLSVDYETARGDLKALRSISFDVNKGEIVGIVGESGCGKSTLISAILRLIAPNT 63 Query: 63 RIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRL 122 R +GE F G+DLL + +R++RG DISI+FQ+PM + NP+I +G Q+++ I HR Sbjct: 64 RFRNGEVRFKGEDLLVASDRHIRDLRGDDISIVFQDPMQTHNPVISIGKQMVD--IQHRS 121 Query: 123 MKNE-EARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEP 181 ++ E A ++L VGIP+ R YP +FSGGMRQR+ IAMAL P LLIADEP Sbjct: 122 KASKAEKLATAAKMLGAVGIPDPEMRLKQYPHEFSGGMRQRIAIAMALMSEPDLLIADEP 181 Query: 182 TTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEE 241 TTALD T++ QI+E L+EL+ E+G +++FI+H L V CDR++ MYAG +VE V E Sbjct: 182 TTALDATLEVQIIERLKELQSEFGCAILFISHHLGVIAELCDRVVVMYAGAVVESGTVRE 241 Query: 242 ILKTPLHPYTKGLLN-STLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQR 300 I P HPYT+ L+ + R + L IPG P+ P GC F RC AM+ C Sbjct: 242 IFHNPKHPYTRRLIECDPGHLKERARVLPTIPGEVPDLANLPEGCIFRDRCDQAMDRC-A 300 Query: 301 EEPPLVNISENHRVACHLIKGE 322 PPL +SE H AC L E Sbjct: 301 SVPPLARLSEGHNAACWLNHAE 322 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 325 Length adjustment: 28 Effective length of query: 296 Effective length of database: 297 Effective search space: 87912 Effective search space used: 87912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory