Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate GFF3390 PGA1_c34430 putrescine transport ATP-binding protein PotG
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Phaeo:GFF3390 Length = 375 Score = 202 bits (514), Expect = 1e-56 Identities = 112/317 (35%), Positives = 187/317 (58%), Gaps = 23/317 (7%) Query: 7 KNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDD 66 +NV+K F G+ A+D++ + I E F +LGPSG GKTT MR++AG + P+ G+++ Sbjct: 21 QNVTKRF--GEFTAIDDLTLGIYEKEFFALLGPSGCGKTTMMRMLAGFETPTEGKIFLSG 78 Query: 67 RLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAK 126 + +A VPP R + M+FQ++AL+P+L+ ++NIAF L K +I +RV+E+ + Sbjct: 79 QDIAP-----VPPNKRLVNMMFQSYALFPHLSVWDNIAFGLKRENKPKHDIAERVQEMLR 133 Query: 127 ILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEV 186 + + P ++SGGQ+QRVALAR+L K P LLLLDEP LD ++R + + ++ Sbjct: 134 LTRLEKFARRKPHQISGGQRQRVALARSLAKAPKLLLLDEPLGALDKKLRQDTQFELMDI 193 Query: 187 QSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINE 246 Q + G T ++V+HD + +A RV V+ G++VQV P+ +Y+ P S+ VA IG++N Sbjct: 194 QEKTGTTFVIVTHDQEEAMTVASRVAVMDNGRIVQVATPDRIYETPNSLYVADFIGDVNI 253 Query: 247 LEGKVTNEGVVIGSLRF-----PVSVSSDRAI-------IGIRPEDVKLSKD-VIKDDSW 293 + G T G ++ + P++V S + + IRPE V +S + + D+ Sbjct: 254 IGGTATPTGPEQYAVNWKDGAAPLTVKSQASFSDGQECHLAIRPEKVTISAERPAEADNT 313 Query: 294 ILVGKGKVKVIGYQGGL 310 + +G++ I Y G + Sbjct: 314 V---QGRILDIAYLGNI 327 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 375 Length adjustment: 29 Effective length of query: 324 Effective length of database: 346 Effective search space: 112104 Effective search space used: 112104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory