Align Inositol transport system ATP-binding protein (characterized)
to candidate GFF2761 PGA1_c28040 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Phaeo:GFF2761 Length = 258 Score = 184 bits (467), Expect = 2e-51 Identities = 102/249 (40%), Positives = 150/249 (60%), Gaps = 6/249 (2%) Query: 5 QPLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDI 64 +P+++ +G+ K +G V AL D+ PGE ++GDNGAGKS+ IK +SG P G++ Sbjct: 2 EPILKARGLVKRYGRVTALDHCDFDLMPGEILAVIGDNGAGKSSLIKAVSGAVVPDAGEV 61 Query: 65 LFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIG----PLKLFD 120 EG+ + F P DA GI TV+Q LAM P +S++ N FMG E +RK G L+ D Sbjct: 62 WLEGRRVQFHTPIDARKEGIETVYQTLAMSPALSIADNMFMGRE-LRKPGWRGSVLRQLD 120 Query: 121 HDYANRITMEEMRKMGI-NLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSAL 179 +I +++ ++G+ ++ +QAV TLSGG+RQ VA+ARA FG+KV+ILDEPT+AL Sbjct: 121 RARMEQIARDKLNELGLATIQNINQAVETLSGGQRQGVAVARAAAFGSKVIILDEPTAAL 180 Query: 180 GVRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEE 239 GV+++ VL I V+ +G+ ++ I+HN+ H V DR V GK L S + Sbjct: 181 GVKESRRVLELIQDVKSRGIPIILISHNMPHVFEVADRIHVHRLGKRLCVIDPKQHSMSD 240 Query: 240 LQDMMAGGQ 248 M G Q Sbjct: 241 AVGYMTGAQ 249 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 258 Length adjustment: 24 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory