Align Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase; EC 1.1.1.18; EC 1.1.1.369; Myo-inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase; MI 2-dehydrogenase/DCI 3-dehydrogenase (uncharacterized)
to candidate GFF3857 PGA1_78p00210 putative oxidoreductase
Query= curated2:Q88S38 (350 letters) >FitnessBrowser__Phaeo:GFF3857 Length = 377 Score = 61.2 bits (147), Expect = 4e-14 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 9/144 (6%) Query: 9 VGIVGIGFIGSDHLHRLTKTVANVDVTAVCDIVPGKAQKALDQQGLTATTYEDYHDLVND 68 +GI+G G I +L ++ + + + AV DI P AQ + GL A T E L+ Sbjct: 6 IGIIGCGNISLTYL-KMIPLFSGMKLCAVADINPKAAQARAAEHGLRAETVEG---LLAA 61 Query: 69 PNVEVVVCTANNEAHYEIVMAALKAGKFTFCEKPLALDAKQCMDIIDSEKKLGRRMLQVG 128 +V VVV EAHY + L+AGK + EKPLAL Q + + G+R L+VG Sbjct: 62 EDVAVVVNLTIPEAHYPLTRRILEAGKHAYSEKPLALTLDQALAL---RNLAGQRGLRVG 118 Query: 129 FM--RHYAPEYVQMKKMIDDGVIG 150 + + MID+G +G Sbjct: 119 SAPDTFLGGSHQLARAMIDEGRVG 142 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 377 Length adjustment: 29 Effective length of query: 321 Effective length of database: 348 Effective search space: 111708 Effective search space used: 111708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory