Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate GFF3595 PGA1_c36500 enoyl-CoA hydratase/isomerase
Query= BRENDA::Q5SLK3 (254 letters) >FitnessBrowser__Phaeo:GFF3595 Length = 258 Score = 153 bits (386), Expect = 4e-42 Identities = 91/250 (36%), Positives = 140/250 (56%) Query: 5 ERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLT 64 E QD V + LNRPE LNA+ ELL L AL+E + +VR ++LTG+ +AF+AG D+ Sbjct: 9 EVQDHVCQIKLNRPEALNALNSELLSELCTALEEADASDKVRCIILTGSEKAFAAGADIK 68 Query: 65 EFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASF 124 E D+ + V + +S + KP++ AV G A G G LA+ D +AA A F Sbjct: 69 EMSDKSFTEVFSTNLFAGVNDRISAIRKPIIAAVAGYALGGGCELAMLCDFIIAADTAKF 128 Query: 125 TTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLME 184 + +G++ G + L R VG +K+ ++ L ++AEEA GLV RVVPA+KL++ Sbjct: 129 GQPEINLGVIAGIGGTQRLTRFVGKSKSMDMNLTGRFMTAEEAERAGLVSRVVPAKKLLD 188 Query: 185 EALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFR 244 EA + A ++A+ K+ + +Y L L+E L E + T+D +EG+ AF Sbjct: 189 EATAAAHKIAEKSLLTAMAVKETVNRSYELPLSEGLLFERRVFHSMFATEDQKEGMAAFL 248 Query: 245 EKRPPRFQGR 254 EKR +F+ + Sbjct: 249 EKREAQFRDK 258 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 258 Length adjustment: 24 Effective length of query: 230 Effective length of database: 234 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory