GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimF in Phaeobacter inhibens BS107

Align 6-carboxyhex-2-enoyl-CoA hydratase (characterized)
to candidate GFF1187 PGA1_c12020 fatty acid oxidation complex FadJ subunit alpha

Query= metacyc::MONOMER-20678
         (699 letters)



>lcl|FitnessBrowser__Phaeo:GFF1187 PGA1_c12020 fatty acid oxidation
           complex FadJ subunit alpha
          Length = 733

 Score =  289 bits (739), Expect = 4e-82
 Identities = 222/758 (29%), Positives = 357/758 (47%), Gaps = 85/758 (11%)

Query: 1   MSEVVTRATQDQVAIVTVDSP--PVNALSAAVRRGILENVNAAVADPAVQAIVLVCAGRT 58
           MS+   +   D VAI+T D P   +N L+      +   V+ A+AD AV+ IV+    + 
Sbjct: 1   MSDFTMKKDADGVAIITWDCPGKTMNVLNGQAMIDLDGLVDDALADDAVKGIVITSGKKD 60

Query: 59  FIAGADITEFGKPPQP----PA---------LNDVIAALENSP---------KPTIAAIH 96
           F  G D+    K  +     PA         +++ +  +E +          KP  AA+ 
Sbjct: 61  FAGGMDLNVLAKMKEDAGDEPARGLFEGIMKMHEGLRKIERAGMDPKTNKGGKPVAAALP 120

Query: 97  GTALGGGLEVALGCH--FRVAVKEAKLGLPEVKLGLLPGAGGTQRLPRAVGPELAVQMIV 154
           GTA+G GLE+ L  H  F     +AK+GLPE+ +G+ PGAGGT RL R +G   A   ++
Sbjct: 121 GTAVGIGLELPLSTHRIFAADNPKAKIGLPEIMVGIFPGAGGTTRLVRKMGAMAAAPFLL 180

Query: 155 GGSPIGAAEALKHGLVEEVVENLVAGAVAFAKKVLAEKRPLRRLRDDDSK-------LAA 207
            G  +   +A   G+++EVVE+ +A A A+    + E +    ++  D+K          
Sbjct: 181 EGKLVDPKKAKGAGIIDEVVEDPLAAARAW----VLEAKDADIVKPWDAKGYKMPGGAPY 236

Query: 208 AKADRSIFTNAVAAMTKKARG-LEAPFACADAIGAAIDLPFEEGLKKEREGFMKLVVSDQ 266
             A    F  A A +  K  G   A  A   A+     +PF+  LK E   F  ++++  
Sbjct: 237 HPAGFMTFLGAAAMVHGKTFGAFPAAKALLSAVYEGALVPFDTALKIEARWFTHVLMNPS 296

Query: 267 SKAQRYAFFAEREAAKVDGV-PDGTKPRPVSRVAIIGAGTMGGGIAMSFANAGIPVTLIE 325
           S+A   + F  +EA +   V P G + + V ++ ++GAG MG GIA+  A AG+ V LI+
Sbjct: 297 SEAMIRSLFLNKEALEKGAVRPAGIEDQSVKKIGVLGAGMMGAGIALVSAQAGMEVVLID 356

Query: 326 TGEEQLKRGLGIMQKNWEATAARGGLPPDAPAKRMALITGLVGLENVKDADLIIEAVFET 385
             +    +G    +   +    RG +  D     ++ IT    L+++K  DLIIEAVFE 
Sbjct: 357 RDQAAADKGKAYTESYLDKGIKRGKVTADKKEAMLSRITATPDLDHLKGCDLIIEAVFED 416

Query: 386 MAVKKEVFTAVDAHAKPGAVLASNTSYLSIDEIAATTKRPQDVLGMHFFSPANVMKLCEI 445
             VK E+   V+A      + ASNTS L I ++A  + RP+  +G+HFFSP   M L EI
Sbjct: 417 PGVKAEMTKKVEAIIPEDCIFASNTSTLPITDLAEASVRPEQFIGIHFFSPVEKMFLVEI 476

Query: 446 VRGAKTAPDALLTAVSIAKKIAKVPVVVGVCDGFVGNRMLAARSKQSEKLLFEGALPQQV 505
           ++G KT   A+  A+   ++I K P+VV     F  NR +     +  +++ EG  P  +
Sbjct: 477 IKGEKTGDRAVAKALDYVRQIRKTPIVVNDARFFYCNRCIIPYVNEGARMITEGVAPALI 536

Query: 506 DAVVTKFGMPMGPFAMGDLAGLDIGWRSRKDRGIKSEIADA------------LCEAGRF 553
           D    + G P+GP  + D   +D+G  ++  R  K+ + DA            + E GR 
Sbjct: 537 DNAARQLGFPVGPIQLTDETSIDLG--AKIARATKAAMGDAYPESAADDLIFWMEEQGRL 594

Query: 554 GQKTGKGYYKYE-----QG------SRAPMPDPEVETLINDTLAKLGLKRRDITDEEILE 602
           G+K+  G++ Y+     QG       + P+ D + + +                  E+ E
Sbjct: 595 GRKSNAGFFDYDDKGKRQGYWKGMQEKYPLADEQPDLI------------------EVQE 636

Query: 603 RMVYPMINEGARILEEKIAARPSDIDVVWLYGYGWPIYRGGPMHYADSVGLKHIAERLSA 662
           R+++  + E  R LEE +     + DV  +  +G+  + GGP+ + D +G  + AER   
Sbjct: 637 RLMFAQVLEAVRALEEGVLMDIREGDVGAILAWGFAPWSGGPLSWLDIIGTPYAAERCDQ 696

Query: 663 YAKATNDPSLEPAPLLARLAAEGKTFASLTQP--SKAA 698
                 +    P PLL  +A +G+TF     P  SKAA
Sbjct: 697 LTAKYGERFTCP-PLLREMAEKGQTFYGRFNPEASKAA 733


Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1103
Number of extensions: 49
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 699
Length of database: 733
Length adjustment: 40
Effective length of query: 659
Effective length of database: 693
Effective search space:   456687
Effective search space used:   456687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory