GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimF in Phaeobacter inhibens BS107

Align 6-carboxyhex-2-enoyl-CoA hydratase (characterized)
to candidate GFF2242 PGA1_c22740 fatty acid oxidation complex subunit alpha

Query= metacyc::MONOMER-20678
         (699 letters)



>lcl|FitnessBrowser__Phaeo:GFF2242 PGA1_c22740 fatty acid oxidation
           complex subunit alpha
          Length = 706

 Score =  607 bits (1564), Expect = e-178
 Identities = 341/692 (49%), Positives = 449/692 (64%), Gaps = 24/692 (3%)

Query: 13  VAIVTVDSPPVNALSAAVRRGILENVNAAVADPAVQAIVLVCAGRTFIAGADITEF--GK 70
           VA + +++P VNAL   +R+ +   ++   AD  V+AIVL  A   F  GADI EF  G 
Sbjct: 10  VAFIELNAPSVNALGLKMRQVLSSAIHELDADEQVKAIVLCSALPLFCGGADIVEFRTGA 69

Query: 71  PPQPPALNDVIAALENSPKPTIAAIHGTALGGGLEVALGCHFRVAVKEAKLGLPEVKLGL 130
               P L D+   +E S KP IAAI G A+GG LE+AL C +RVA  +A +GLPE+KLGL
Sbjct: 70  VWDKPDLPDLCVMIETSKKPIIAAIAGPAMGGALEIALACDYRVATPDAVMGLPEIKLGL 129

Query: 131 LPGAGGTQRLPRAVGPELAVQMIVGGSPIGAAEALKHGLVEEVVEN---LVAGAVAFAKK 187
           LPGAGGTQRLPR  G E A QMI+ G P+    AL  GLV+ + EN     A  + FA +
Sbjct: 130 LPGAGGTQRLPRIAGLEAATQMILSGDPVKGEYALSCGLVDALFENDQDFRAHVLGFATR 189

Query: 188 VLAEKRPLRRLRDDDSKLAAAKADRSIFTNAVAAMTKKARGLEAPFACADAIGAAIDLPF 247
           V  E  P R   D   +    K   + F + +A  +K    L AP  C  +I AA ++P 
Sbjct: 190 VSHEGDPKRSCADMTVRHPDPKGYLTGFRDQIAHTSKN---LVAPERCLVSIEAACEMPL 246

Query: 248 EEGLKKEREGFMKLVVSDQSKAQRYAFFAEREAAKVDGVPDGTKPRPVSRVAIIGAGTMG 307
            EGL++E+ GF +L+ + QS+A R+ FFAERE  KV GV    +PR ++ VA+IGAGTMG
Sbjct: 247 AEGLEQEKAGFAELLDTPQSRAGRHLFFAERECTKVPGVTRADRPRDIASVAVIGAGTMG 306

Query: 308 GGIAMSFANAGIPVTLIETGEEQLKRGLGIMQKNWEATAARGGLPPDAPAKRMALITGLV 367
            GIA++F  AG PVTL+ET +  L++GL  ++++++  A +G L  D      A  TG +
Sbjct: 307 RGIAIAFLQAGYPVTLLETTQGALEQGLEKVREHFQRAAQKGRLSADRAEAISANATGTL 366

Query: 368 GLENVKDADLIIEAVFETMAVKKEVFTAVDAHAKPGAVLASNTSYLSIDEIAATTKRPQD 427
               +  ADLIIEA FE+M VK+++F A+D HAKPGA+LASNTS L +DEIA  T RP+D
Sbjct: 367 SYAGLAKADLIIEAAFESMNVKRQIFEALDLHAKPGAILASNTSTLDLDEIATVTSRPED 426

Query: 428 VLGMHFFSPANVMKLCEIVRGAKTAPDALLTAVSIAKKIAKVPVVVGVCDGFVGNRMLAA 487
           V+G+HFFSPANVM+L E+VRGAKTAPD + TA+++AKKI K+PV VGVC GFVGNRML  
Sbjct: 427 VIGLHFFSPANVMRLLEVVRGAKTAPDVIATAITVAKKIRKLPVTVGVCYGFVGNRMLEP 486

Query: 488 RSKQSEKLLFEGALPQQVDAVVTKFGMPMGPFAMGDLAGLDIGWRSRKDRGIKSEIA--- 544
             ++  +LL EGA P+QVD V+  FGM MG  AM DLAG+D+G R R++R  +SEIA   
Sbjct: 487 YFREGSRLLLEGATPKQVDDVLEGFGMAMGIHAMADLAGVDVGARVRQER--RSEIAHDP 544

Query: 545 ------DALCEAGRFGQKTGKGYYKYEQGSRAPMPDPEVETLINDTLAKLGLKRRDITDE 598
                 D L E GR GQKTG+G Y YE   R  + DPE+  + ++     G+KRRDI D+
Sbjct: 545 TYQAVQDRLFELGRLGQKTGRGSYVYE--GRTRVEDPEMVQISSELADLHGVKRRDIDDQ 602

Query: 599 EILERMVYPMINEGARILEEKIAARPSDIDVVWLYGYGWPIYRGGPMHYADSVGLKHIAE 658
           EILER ++P+INEG  ILEE IA RP D D++W+ GYG+P +RGGPMHYAD +GL  I E
Sbjct: 603 EILERCLFPLINEGFLILEEGIATRPGDCDLIWVNGYGFPNWRGGPMHYADEIGLSQIME 662

Query: 659 RLSAYAK---ATNDPSLEPAPLLARLAAEGKT 687
           R++ Y +   A  +    PAPLL +LA  G T
Sbjct: 663 RMTHYRQSLGAYGEMWFTPAPLLEQLATSGVT 694


Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1200
Number of extensions: 71
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 699
Length of database: 706
Length adjustment: 39
Effective length of query: 660
Effective length of database: 667
Effective search space:   440220
Effective search space used:   440220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory