GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimF in Phaeobacter inhibens BS107

Align 6-carboxyhex-2-enoyl-CoA hydratase (characterized)
to candidate GFF400 PGA1_c04110 putative fatty acid oxidation complex subunit alpha

Query= metacyc::MONOMER-20678
         (699 letters)



>lcl|FitnessBrowser__Phaeo:GFF400 PGA1_c04110 putative fatty acid
           oxidation complex subunit alpha
          Length = 697

 Score =  534 bits (1375), Expect = e-156
 Identities = 302/709 (42%), Positives = 433/709 (61%), Gaps = 25/709 (3%)

Query: 1   MSEVVTRATQDQVAIVTVDSPPVNALSAAVRRGILENVNAAVADPAVQAIVLVCAGRTFI 60
           M+E +       +A++   +PPVNAL   VRRG+L  +  A  + A +A+++   GRT+ 
Sbjct: 1   MTEAIVYERIGDIAVLAAQNPPVNALGIDVRRGLLAGIERAEKEGA-RAVLIYGEGRTYF 59

Query: 61  AGADITEFGKPPQPPALNDVIAALENSPKPTIAAIHGTALGGGLEVALGCHFRVAVKEAK 120
           AGADI EFGKP + P L D+   +E +    ++A+HGTALGGGLEVAL  H+R+AV  AK
Sbjct: 60  AGADIREFGKPMEEPGLPDLCNRIEAAKLIVVSALHGTALGGGLEVALSSHYRIAVPGAK 119

Query: 121 LGLPEVKLGLLPGAGGTQRLPRAVGPELAVQMIVGGSPIGAAEALKHGLVEEVVE-NLVA 179
           +GLPEV LG++PGAGGTQRLPR  G E A++MI  G  + AAEA   G+++ + E N   
Sbjct: 120 MGLPEVHLGIIPGAGGTQRLPRVAGTEAALEMITTGRHVAAAEAFDKGVIDRIAEGNPRE 179

Query: 180 GAVAFAKKVLAEKRPLRRLRDDDSKLAAAKADRSIFTNAVAAMTKKARGLEAPFACADAI 239
             +A+ +++L +  P R + D     A    D   F      +  + RG  +P     A+
Sbjct: 180 VGLAYTRELLEQNAPRRPVCDMP---APEPVD---FDATYERVLVRGRGQLSPAIAVRAV 233

Query: 240 GAAIDLP-FEEGLKKEREGFMKLVVSDQSKAQRYAFFAEREAAKVDGVPDGTKPRPVSRV 298
            AA + P F +G+++ERE FMKL+ SDQ +   +AFF+ER  +K+  + D   PR V+ +
Sbjct: 234 QAACEAPSFLDGVRQERELFMKLMESDQRQGLIHAFFSERAVSKLPELVD-VFPRDVAAM 292

Query: 299 AIIGAGTMGGGIAMSFANAGIPVTLIETGEEQLKRGLGIMQKNWEATAARGGLPP---DA 355
            +IG GTMG GIA +   AG+ V LIE  E         ++ N      RG +     DA
Sbjct: 293 GVIGGGTMGAGIATAALLAGLSVVLIERDEAASVAARERIEGNLRGALKRGKISQSQFDA 352

Query: 356 PAKR-MALITGLVGLENVKDADLIIEAVFETMAVKKEVFTAVDAHAKPGAVLASNTSYLS 414
                + L T    L  V   DL++EAVFE M VK++VF A+D H KPGA+LASNTSYL 
Sbjct: 353 ILNETLKLATDYAALSQV---DLVVEAVFEDMDVKRDVFAALDEHCKPGAILASNTSYLD 409

Query: 415 IDEIAATTKRPQDVLGMHFFSPANVMKLCEIVRGAKTAPDALLTAVSIAKKIAKVPVVVG 474
           I++IAA T RP DV+G+HFFSPA+VMKL E+V   +TAPD + T  ++ K++ K  V  G
Sbjct: 410 INDIAAATSRPSDVIGLHFFSPAHVMKLLEVVVADQTAPDVVATGFALGKRLKKTSVRSG 469

Query: 475 VCDGFVGNRMLAARSKQSEKLLFEGALPQQVDAVVTKFGMPMGPFAMGDLAGLDIGWRSR 534
           VCDGF+GNR++ +  K ++ ++ +GA P Q+D V+T FG  MGPFA+ DLAGLDIGW +R
Sbjct: 470 VCDGFIGNRIMNSYRKAADYMVLDGASPYQIDKVMTGFGFAMGPFAVADLAGLDIGWAAR 529

Query: 535 KDRGIKSE-------IADALCEAGRFGQKTGKGYYKYEQGSRAPMPDPEVETLINDTLAK 587
           K R    +        +D LCE G FGQKTG+G+Y YE+G R   P+P+V   I      
Sbjct: 530 KRRAPTLDPRERVVHFSDMLCEGGDFGQKTGRGFYVYEEGKRGGTPNPQVAEYIERDQRD 589

Query: 588 LGLKRRDITDEEILERMVYPMINEGARILEEKIAARPSDIDVVWLYGYGWPIYRGGPMHY 647
            G+  +   ++E+L R +  M+NE A+++ E IA RP D+D+V L+GYG+P + GGP+ +
Sbjct: 590 QGVTPQIFANDEVLRRYMCAMVNEAAKVVGEGIARRPLDVDMVLLFGYGFPRFWGGPLKW 649

Query: 648 ADSVGLKHIAERLSAYAKATNDPSLEPAPLLARLAAEGKTFASLTQPSK 696
           AD  G   I + +  YAK  +    +PAPLL ++ AEG++F  L + ++
Sbjct: 650 ADLQGPDSILKDIRRYAK-EDAFFWQPAPLLEQMVAEGRSFDDLNKEAR 697


Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1149
Number of extensions: 68
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 699
Length of database: 697
Length adjustment: 39
Effective length of query: 660
Effective length of database: 658
Effective search space:   434280
Effective search space used:   434280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory