Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate GFF2283 PGA1_c23150 acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta
Query= uniprot:G1UHX5 (328 letters) >FitnessBrowser__Phaeo:GFF2283 Length = 331 Score = 219 bits (558), Expect = 7e-62 Identities = 127/310 (40%), Positives = 168/310 (54%), Gaps = 1/310 (0%) Query: 1 MSEITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAE 60 M EIT+++A+N AL + +R D + GED+ G F++ GL EFG ER DTP+AE Sbjct: 1 MREITLSQAVNEALAEEMRRDETVFIIGEDVAEAGTPFKVLSGLVEEFGTERVVDTPIAE 60 Query: 61 SAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYG 120 +G AVG AM G RPVV++ F F Y +QL + AK + G + PL +R G Sbjct: 61 PGFMGLAVGAAMTGTRPVVDLMFGDFIYLIMDQLCNQAAKTHYMSGGKMSAPLVLRTNMG 120 Query: 121 GGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRK 180 HS S PGL V P++A +A L++ +I +PVV E K +Y K Sbjct: 121 ATRRSAAQHSQSLHALVAHIPGLKVAMPSSAYEAKGLMKTAIRDNNPVVIFEDKLMYNDK 180 Query: 181 EALGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLMP 240 + P G A I+R G TLIA V AAE A+ G D EVID RT++P Sbjct: 181 APVPEEEFLIPFGEANIKRAGNDITLIATSSMVQVCEAAAEILAKEGIDAEVIDPRTIVP 240 Query: 241 LDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYP- 299 LD+ T+ AS ++T R +VV E H G EIA RI E+ FYHL+APV R+ DVP P Sbjct: 241 LDEETLIASAKKTSRVIVVDEGHQSYGITGEIAGRINEKAFYHLDAPVLRMGAMDVPVPF 300 Query: 300 PPLLERHYLP 309 P LE +P Sbjct: 301 SPALEDITVP 310 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 331 Length adjustment: 28 Effective length of query: 300 Effective length of database: 303 Effective search space: 90900 Effective search space used: 90900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory