GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pad-dh in Phaeobacter inhibens BS107

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate GFF3227 PGA1_c32800 aldehyde dehydrogenase

Query= BRENDA::P05091
         (517 letters)



>lcl|FitnessBrowser__Phaeo:GFF3227 PGA1_c32800 aldehyde
           dehydrogenase
          Length = 802

 Score =  330 bits (847), Expect = 9e-95
 Identities = 200/473 (42%), Positives = 268/473 (56%), Gaps = 26/473 (5%)

Query: 40  FINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDAS 99
           FIN E+        F + NP+TGEV+  +++  + DVD AV AAR A    + W     +
Sbjct: 60  FINGEF--TAPGDGFDSKNPATGEVLATLSQATQSDVDSAVDAARKA---QTKWSAAGGA 114

Query: 100 HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK 159
            R R L  +A L+++     A LETLDNGKP   S  +D+ +  +   Y+AG A     +
Sbjct: 115 ARARYLYAIARLMQKHARLFAVLETLDNGKPIRESRDIDVPLAQRHFYYHAGMAQLMESE 174

Query: 160 TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL 219
                         E +GVCGQIIPWNFPLLM AWK+ PA+A GN VV+K AE T LTAL
Sbjct: 175 L----------PDREALGVCGQIIPWNFPLLMLAWKVAPAIAMGNTVVLKPAEYTSLTAL 224

Query: 220 YVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL 279
             A++ ++AG P GVVNIV G G      + +  DVDK+AFTGST +GR I+ A   S  
Sbjct: 225 LFADICRQAGLPKGVVNIVTGDGAVGEMIVGA--DVDKIAFTGSTAVGRRIREATAGSG- 281

Query: 280 KRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERS 339
           K +TLELGGKSP I+  DAD+D A+E    A++FNQGQ CCAGSR  VQE I + F  + 
Sbjct: 282 KALTLELGGKSPYIVFDDADIDSAIEGLVDAIWFNQGQVCCAGSRLLVQEGIAERFHTKL 341

Query: 340 VARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYI---NTGKQEGAKLLCGGGIAADRGY 396
             R     +GNP D   + G  VD  Q   I   +     G+   A++        +RG 
Sbjct: 342 RVRMDKLRIGNPLDKSIDVGAIVDPVQLTTISEMVAANTAGRMHQAQV-----AVPERGC 396

Query: 397 FIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKA 456
           F  PT+   +     + +EEIFGPV+    F+T  E V  ANN+ YGLAA ++T++++ A
Sbjct: 397 FYPPTLIEGLAPSDALMQEEIFGPVLVSTTFRTPSEAVELANNTRYGLAATLWTENVNLA 456

Query: 457 NYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVT 509
             ++  L AG VWVN  ++F A + FGG + SG GRE G  GL AYT+ K  T
Sbjct: 457 LDIAPKLVAGVVWVNATNLFDAAAGFGGTRESGFGREGGWEGLSAYTKPKGKT 509



 Score = 86.3 bits (212), Expect = 4e-21
 Identities = 71/253 (28%), Positives = 119/253 (47%), Gaps = 22/253 (8%)

Query: 57  VNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDR 116
           ++  +G ++  V  G+++DV  AV+AA  A    + W +     R ++L  + + +    
Sbjct: 551 IHSKSGGLLGHVGLGNRKDVRNAVEAAAGA----NAWSKTTGHLRAQILYYIGENLSARV 606

Query: 117 TYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKT--IPIDGDFFSYTRHE 174
              A       GK        +++  ++ L   A WADKY G+   +PI G   +    E
Sbjct: 607 GEFADRIDRMTGKSQGAQ---EVEASIQRLFTAAAWADKYDGQAHGVPIRG--VALAMKE 661

Query: 175 PVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGV 234
           PVGV G +     PLL     + PA+A GN VV+  +E  PL+A     +++ +  P GV
Sbjct: 662 PVGVIGALCADEAPLLGLVSVMAPAIAMGNRVVLAASEAYPLSATDFYQVLETSDLPGGV 721

Query: 235 VNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNII 294
           VNI+ G      + +ASH +VD V    S+++  +I+  A + NLKR  +  G       
Sbjct: 722 VNILTGRHAEMASPLASHLNVDAVWSFSSSDLSAMIE-EASAGNLKRTWVNNG------- 773

Query: 295 MSDADMDWAVEQA 307
                MDW+ + +
Sbjct: 774 ---LAMDWSADHS 783


Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 986
Number of extensions: 39
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 517
Length of database: 802
Length adjustment: 38
Effective length of query: 479
Effective length of database: 764
Effective search space:   365956
Effective search space used:   365956
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory