GapMind for catabolism of small carbon sources

 

Aligments for a candidate for davT in Phaeobacter inhibens BS107

Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate GFF3422 PGA1_c34750 putative aminotransferase class 3

Query= SwissProt::P50457
         (421 letters)



>lcl|FitnessBrowser__Phaeo:GFF3422 PGA1_c34750 putative
            aminotransferase class 3
          Length = 1009

 Score =  144 bits (364), Expect = 9e-39
 Identities = 121/399 (30%), Positives = 179/399 (44%), Gaps = 19/399 (4%)

Query: 34   LKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLAEKIN 93
            L D  G  Y+D  A   V + GH HP + A    QL++       + P ++    AEKI 
Sbjct: 615  LFDEWGRPYLD--AYNNVPHVGHAHPRIQAIAADQLKRMNSNTRYLHPAQN--AFAEKI- 669

Query: 94   ALAPVSGQAKTAFFT-TGAEAVENAVKIARAHTGRPGVIAFSGGFHGRTYMTMALTGKVA 152
             L+ +    +  FF  +G EA E A+++ARAHTG  G++    G+HG T   + ++    
Sbjct: 670  -LSKMPDHLEVCFFVNSGTEANELALRLARAHTGAKGMVTPDHGYHGNTTGAIDISAYKF 728

Query: 153  PYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIER--------LFKSDIEAKQVAAIIF 204
              K G GP    V  V    D  G   +D     ++        + K       VA  I 
Sbjct: 729  NAKGGVGPSDW-VELVEVADDYRGTYGRDDPQRAQKYADLVDPAIAKLQASGHGVAGFIA 787

Query: 205  EPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKL-FAMDHYADKPDLM 263
            E     GG  + PK  + A+       G + IADEVQ+G  R G+  F  +H    PD++
Sbjct: 788  ETFPSVGGQIIPPKGYLPAVYEKIRAAGGICIADEVQTGLGRLGEYYFGFEHQGASPDIV 847

Query: 264  TMAKSLAGGMPLSGVVGNANIMDAPAPGG-LGGTYAGNPLAVAAAHAVLNIIDKESLCER 322
             + K +  G PL  +V    I D+ A G     T+ G+ L+      VLNI+D+E L E 
Sbjct: 848  VLGKPIGNGHPLGVLVTTRAIADSFAQGPEFFSTFGGSTLSCRIGTEVLNIVDEEGLQEN 907

Query: 323  ANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQG 382
            A Q G  L N L D +    AI  VRG+G  I VE      G  ++ I   ++ R     
Sbjct: 908  ARQRGADLLNGLRDLQSRHQAIGDVRGMGLFIGVELIRTD-GSEASEICAYVKNRMRDHR 966

Query: 383  LLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALSD 421
            +L+ + G   N+++   PLTI     +  +K L   LS+
Sbjct: 967  ILIGSEGPKDNILKIRPPLTIDAEGIEMILKTLDSILSE 1005


Lambda     K      H
   0.319    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 991
Number of extensions: 49
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 421
Length of database: 1009
Length adjustment: 38
Effective length of query: 383
Effective length of database: 971
Effective search space:   371893
Effective search space used:   371893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory