Align Glycine betaine/proline/choline transporter VP1723 (characterized)
to candidate GFF3740 PGA1_262p01440 BCCT transporter
Query= SwissProt::Q87NZ5 (553 letters) >FitnessBrowser__Phaeo:GFF3740 Length = 514 Score = 254 bits (650), Expect = 4e-72 Identities = 173/513 (33%), Positives = 262/513 (51%), Gaps = 55/513 (10%) Query: 41 IHNRVFAISGMAIVLFVVATLTFRQQVEPFFAGLRAWLVSNLDWFFLASGNVF------- 93 I+ +F +SG I LF VA L GL A + DW F + F Sbjct: 15 INKPLFLLSGGFIALFCVAALVNLD-------GLSALV----DWGFNIAATYFGLYWQIL 63 Query: 94 ----VIVCLVLIVTPLGRVRIGGTEATPDYSYAGWLAMLFAAGMGIGLVFFGVSEPMSHF 149 ++ LVL + P GR +GG ATP+++ W +M+ + G VF+ EP++HF Sbjct: 64 LLATFLIGLVLCILPGGRAIMGGL-ATPEFTTFQWGSMIMCTLLAGGGVFWAAGEPIAHF 122 Query: 150 SSALGGVNIENGVRTDWAPLGGAVGDTDAASALGMAATIYHWALHPWSIYALLALGLAI- 208 + PL GA G ++AA +A + HW W+I L+ + + Sbjct: 123 LYS--------------PPLYGAEGGSEAAVTPAIAQSFMHWGFLAWAILGSLSTVMLMH 168 Query: 209 FSFNKGLPLTMRSIFYPLFGER-VWGWVGHIIDILAVVATVFGLATSLGYGASQAATGLN 267 + + KGLPL R++ YP+FG++ + G +G I D +++A V G +G+ Q + GL+ Sbjct: 169 YHYEKGLPLAPRTLLYPVFGDKAINGPIGVIADASSIIAVVAGTVGPIGFLGLQVSYGLS 228 Query: 268 FLFGVPMTDTTQVVLIVVITALALISVVAGLDSGVKRLSEINMILAAMLLFFVIIVGPTM 327 LFG+P TQ V+I + AL IS + GL G++ LS+IN+ILAA+LL +V++ GPT Sbjct: 229 DLFGIPDVFATQFVVIGALVALYTISAMTGLSRGIQLLSKINVILAAVLLIYVLLAGPTG 288 Query: 328 AILTGFFDNIASYITNIPALSMPFEREDV------NYSQGWTAFYWAWWISWSPFVGMFI 381 I FF A+Y+ N M R D + WT F+W W++ + P + MFI Sbjct: 289 FIFGSFFSGFATYLGNF--FQMALYRGDAAVFGAPGWLGWWTVFFWGWFMGYGPLMAMFI 346 Query: 382 ARVSRGRSVREFIICVILIPSTVCVLWMTAFGGTAISQYVND--GYEAVFNA-ELPLKLF 438 ARVSRGRS+R II + +I V W T GGT I+ + + A F LP L Sbjct: 347 ARVSRGRSIRSIIIMLSIIAPIVTNFWFTIIGGTGIAMELAEPGTVSAAFEGFNLPAALL 406 Query: 439 AMLDVMPFAEITSVVGIILVVVFFITSSDSGSLVIDTIAAGGKVDAP-TPQRVFWCTFEG 497 A+ + +P + S++ +IL +F T+ DS S VI G D P T RVFW G Sbjct: 407 AITNNLPMGFLVSILFLILTTIFVATTGDSMSYVISATMTKG--DTPSTAVRVFWGIAMG 464 Query: 498 LVAIALML--GGGLAAAQAMAVTTGLPFTIVLL 528 ++A+ L+ GG++ Q+ V T +P +++LL Sbjct: 465 VMAVILISVGSGGVSKLQSFIVVTAVPVSLILL 497 Lambda K H 0.327 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 807 Number of extensions: 40 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 553 Length of database: 514 Length adjustment: 35 Effective length of query: 518 Effective length of database: 479 Effective search space: 248122 Effective search space used: 248122 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory