Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate GFF3323 PGA1_c33760 putative glycine betaine transport ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Phaeo:GFF3323 Length = 351 Score = 300 bits (769), Expect = 2e-86 Identities = 150/262 (57%), Positives = 199/262 (75%), Gaps = 1/262 (0%) Query: 4 IEIRNVYKIFGHDAKKALTMVED-GLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLS 62 +EI NV+KIFGH+ + AL + D GL KA++LS G VG+ D+SL + G+IF IMGLS Sbjct: 7 VEISNVWKIFGHNPQAALQAIRDRGLSKAEVLSEMGAVVGVADISLSVNRGEIFCIMGLS 66 Query: 63 GSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTV 122 GSGKSTLVRH NRL+EPT+G++ +G +++ LGAK L+ FR ++ MVFQ+FALMPHR+V Sbjct: 67 GSGKSTLVRHFNRLLEPTAGKIEIEGTDVMALGAKNLQQFRNNKIGMVFQNFALMPHRSV 126 Query: 123 LQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADT 182 L NV +R V+K++ +D V L + +KF H+LSGGM+QRVGLARALAA+ Sbjct: 127 LDNVAMPLEIRQVAKNERMRQAAAILDVVELGAWSSKFAHELSGGMQQRVGLARALAANP 186 Query: 183 DVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQV 242 DV+LMDE FSALDPLIR +QD+ ++L + L KT +FITHDLDEA+RIG IAI+RDG++ Sbjct: 187 DVLLMDEPFSALDPLIRRQLQDEFIRLSKILKKTTIFITHDLDEAVRIGDRIAIMRDGKM 246 Query: 243 VQVGTPNDILDNPANDYVARFV 264 VQ+GT DI+ +PA+DYVA FV Sbjct: 247 VQMGTAEDIVMHPADDYVADFV 268 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 351 Length adjustment: 27 Effective length of query: 248 Effective length of database: 324 Effective search space: 80352 Effective search space used: 80352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory