Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate GFF2520 PGA1_c25590 putative glycine betaine/L-proline transport system, ATP binding subunit
Query= CharProtDB::CH_001555 (400 letters) >FitnessBrowser__Phaeo:GFF2520 Length = 350 Score = 275 bits (703), Expect = 1e-78 Identities = 139/278 (50%), Positives = 198/278 (71%), Gaps = 1/278 (0%) Query: 4 KLEIKNLYKIFGEHPQRAFKYIE-QGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGL 62 K++I+NLYKIFG +P + QG+ K Q+LE+ LG++D S+ I+ GEI VIMGL Sbjct: 5 KIQIRNLYKIFGANPGTVLPMVRNQGMGKSQLLEEHKHVLGLQDISIDIQAGEISVIMGL 64 Query: 63 SGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMT 122 SGSGKST++R LNRLIEPT G++L+DG D+ + +LRE+R++ ++MVFQ FAL+PH T Sbjct: 65 SGSGKSTLIRHLNRLIEPTAGEILLDGQDVMDLDPVQLREMRQRSMSMVFQKFALLPHKT 124 Query: 123 VLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALAIN 182 VL+N + + G + A L +VGL + + YP +LSGGM+QRVG+ARAL + Sbjct: 125 VLENAETALRVRGDDRATCEAAARKWLDRVGLSGFENRYPSQLSGGMQQRVGIARALTAD 184 Query: 183 PDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGE 242 DI+L+DEAFSALDPLIRT+MQD L++LQ + +TIVFI+HDLDEA+++ D + I+++G Sbjct: 185 TDIMLLDEAFSALDPLIRTDMQDLLLELQTELHKTIVFITHDLDEALKLADHLVILKDGA 244 Query: 243 VVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIA 280 VVQ G P I+ NPA+ Y+ F ++ ++V A IA Sbjct: 245 VVQQGPPQGIVMNPADPYIEAFVGDINRARVLRAGTIA 282 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 350 Length adjustment: 30 Effective length of query: 370 Effective length of database: 320 Effective search space: 118400 Effective search space used: 118400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory