GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mcmA in Phaeobacter inhibens BS107

Align Methylmalonyl-CoA mutase; MCM; EC 5.4.99.2 (characterized)
to candidate GFF373 PGA1_c03840 methylmalonyl-CoA mutase large subunit

Query= SwissProt::P27253
         (714 letters)



>lcl|FitnessBrowser__Phaeo:GFF373 PGA1_c03840 methylmalonyl-CoA
           mutase large subunit
          Length = 655

 Score =  403 bits (1036), Expect = e-116
 Identities = 245/657 (37%), Positives = 366/657 (55%), Gaps = 23/657 (3%)

Query: 67  MYTAQPWTIRQYAGFSTAKESNAFYRRNLAAGQKGLSVAFDLATHRGYDSDNPRVAGDVG 126
           M   +PW IR YAG STA  SNA YR NLA GQ GLSVAFDL T  GYDSD+    G+VG
Sbjct: 4   MQKDRPWLIRTYAGHSTASASNALYRANLAKGQTGLSVAFDLPTQTGYDSDHVLARGEVG 63

Query: 127 KAGVAIDTVEDMKVLFDQIPLDKMSVSMTMNGAVLPVLAFYIVAAEEQGVTPDKLTGTIQ 186
           K GV +  + DM+ LFDQIPL++M+ SMT+N     +L+ YI  AEEQG    KL GT+Q
Sbjct: 64  KVGVPVCHLGDMRSLFDQIPLEQMNTSMTINATAPWLLSLYIAVAEEQGADVSKLQGTVQ 123

Query: 187 NDILKEYLCRNTYIYPPKPSMRIIADIIAWCSGNMPRFNTISISGYHMGEAGANCVQQVA 246
           ND++KEYL R TY+ PPKPS+++IAD+  +C  N P++N +++  YH+ EAGA   Q++A
Sbjct: 124 NDLIKEYLSRGTYVCPPKPSLKMIADVAEYCYTNAPKWNPMNVCSYHLQEAGATPEQELA 183

Query: 247 FTLADGIEYIKAAISAGLKIDDF---APRLSFFFGIGMDLFMNVAMLRAARYLWSEAV-S 302
           F LA   + +   +   +  +DF     R+SFF   G+     +  +RA   LW E    
Sbjct: 184 FALATA-QAVLDELKPRITPEDFPAMVGRISFFVNAGIRFVTEMCKMRAFVDLWDEICRD 242

Query: 303 GFGAQDPKSLALRTHCQTSGWSLTEQDPYNNVIRTTIEALAATL---GGTQSLHTNAFDE 359
            +G +DPK    R   Q +   LTEQ P NNV R  IE LA TL      +++   A++E
Sbjct: 243 RYGVEDPKFRRFRYGVQVNSLGLTEQQPENNVYRILIEMLAVTLSKKARARAVQLPAWNE 302

Query: 360 ALGLPTDFSARIARNTQIIIQEESELCRTVDPLAGSYYIESLTDQIVKQARAIIQQIDEA 419
           ALGLP  +  + +   Q I+  E++L    D   G+  +++  + +   ARA +  ++  
Sbjct: 303 ALGLPRPWDQQWSMRMQQILAYETDLLEYGDLFDGNPAVDAKVEDLKTGARAELANLESM 362

Query: 420 GGMAKAIEAGLPKRMIEEASAREQSLIDQGKRVIVGVNKYKLDH----EDETDVLEIDNV 475
           GG   +IE    K  + +++A   + I++ + ++VGVNK+        + E   + + + 
Sbjct: 363 GGAVASIE--YMKGRLVDSNAERLNRIEKNETIVVGVNKWTEGEPSPLQTEDGGIMVVDP 420

Query: 476 MVRNEQIASLERIRATRDDAAVTAALNALTHAAQHNENLLAAAVNAARVRATLGEISDAL 535
            V  EQI  L+  R+ RDD AV +AL AL  AAQ+ +N++  ++ AA+   T GE ++ +
Sbjct: 421 AVEQEQINRLDDWRSGRDDDAVQSALAALRAAAQNGDNIMPPSIAAAKAGVTTGEWAEEM 480

Query: 536 EVAFDRYLVPSQCVTGVIAQSYHQSEKSASEFDAIVAQTEQFLADNGRRPRILIAKMGQD 595
              +  Y  P    TGV   + +++E      D + A ++Q     GRR + L+ K G D
Sbjct: 481 RKVYGTYRGP----TGVSGSASNKTEGLDELRDKVNAVSDQL----GRRLKFLVGKPGLD 532

Query: 596 GHDRGAKVIASAYSDLGFDVDLSPMFSTPEEIARLAVENDVHVVGASSLAAGHKTLIPEL 655
           GH  GA+ IA    D G D+    +  TPEE+   A+ +D HVVG S L+  H  LI EL
Sbjct: 533 GHSNGAEQIAFRARDCGMDITYDGIRMTPEELVASAIADDAHVVGMSILSGSHLPLIEEL 592

Query: 656 VEALKKWGREDICVVAGGVIPPQDYAFLQERGVAAIYGPGTPMLDSVR-DVLNLISQ 711
           +  + + G   + V+ GG+IP  D   L++ GVA +Y P    L+++  D++ L  Q
Sbjct: 593 MGRMTEAGLSHVPVIVGGIIPDDDADRLKKMGVARVYTPKDFELNAIMGDIVELAKQ 649


Lambda     K      H
   0.318    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 960
Number of extensions: 46
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 714
Length of database: 655
Length adjustment: 39
Effective length of query: 675
Effective length of database: 616
Effective search space:   415800
Effective search space used:   415800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory