Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate GFF3078 PGA1_c31290 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088337 (275 letters) >FitnessBrowser__Phaeo:GFF3078 Length = 306 Score = 155 bits (392), Expect = 1e-42 Identities = 89/276 (32%), Positives = 144/276 (52%), Gaps = 13/276 (4%) Query: 1 MIVTIVGWLVLFVFLPNLMIIGTSF---LTRDDASFVKMVFTLDNYTRLL---------- 47 M+ ++ W + + LP L ++ SF L + K V+TL+NY L+ Sbjct: 20 MLGLVLFWTIGLIILPQLSMLDFSFRPNLPPPEIGGPKDVYTLENYKYLVFGPEGGGQDY 79 Query: 48 DPLYFEVLLHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRI 107 + + V +L A+ TL L+L YP A++LA+ + +LI+P+W N ++R Sbjct: 80 NAVDLRVFFRTLVAAVCVTLFNLILCYPIAYYLAQTKGNHIRIFALMLIIPYWINEILRA 139 Query: 108 YGLKIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLD 167 + L+I G LN L+ +GV DTP + A+ GL Y + M+ P+Y+ IE LD Sbjct: 140 FALRIIFGESGVLNTALVGMGVFDTPFDFIRNDIALYAGLGYAYILLMIFPIYNVIESLD 199 Query: 168 KPLLEAARDLGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIG 227 + +EAARD+GAS + R++IP PGI +GC +V + + G ++GG +L Sbjct: 200 RNQIEAARDMGASWAKIHQRVVIPYAKPGISSGCTMVFMLSAGALAAPQILGGPSSLWFT 259 Query: 228 NVIKVQFLNIRDWPFGAATSITLTIVMGLMLLVYWR 263 +I QF + DWP GAA ++ L + L++L R Sbjct: 260 QLIYQQFNDNSDWPQGAAYAVVLLVTCILLVLAVMR 295 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 306 Length adjustment: 26 Effective length of query: 249 Effective length of database: 280 Effective search space: 69720 Effective search space used: 69720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory