Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate GFF328 PGA1_c03390 acetoacetyl-CoA reductase PhaB
Query= SwissProt::Q9HK58 (254 letters) >FitnessBrowser__Phaeo:GFF328 Length = 240 Score = 105 bits (262), Expect = 8e-28 Identities = 75/242 (30%), Positives = 128/242 (52%), Gaps = 10/242 (4%) Query: 7 KNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHKVKVDQS 66 +NA++TGGSRGIG AI+ L +G + +YA +D A + ++ G+K +K V Sbjct: 3 RNALVTGGSRGIGAAISQALKAEGYTVAATYAGNDEAA---AKFTNETGIKTYKWDVASY 59 Query: 67 DPYESIRFAEKAIETFGKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVESHYFITQRI 126 + +S K G + I+V NAGI F +++++ +++V N+ + I Sbjct: 60 E--DSAAGIAKVEADIGPIDIVVANAGITRDAPFHKMTLEQWQQVIDTNLTGVFNTVHPI 117 Query: 127 AKNMIENKINGRILLISSISAHVGGEFQTHYTTTKSALNGFMHSIAIVLGKYGILVNSLE 186 M E K GR+++ISSI+ G Q +Y TK+ G + S+A + GI N++ Sbjct: 118 WPGMRERKF-GRVIVISSINGQKGQFAQVNYAATKAGDLGIVKSLAQEGARAGITANAIC 176 Query: 187 PGTILTDINKEDLSNQEK-RAYMERRTVVGRLGLPEDMVAPALFLLSDDNTYVTGTELLA 245 PG I T++ ++ EK R + + GRLG PE++ FL S+D+ ++ G+ + A Sbjct: 177 PGYIATEM---VMAVPEKVRESIIGQIPAGRLGEPEEIARCVAFLASEDSGFINGSTISA 233 Query: 246 DG 247 +G Sbjct: 234 NG 235 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 240 Length adjustment: 24 Effective length of query: 230 Effective length of database: 216 Effective search space: 49680 Effective search space used: 49680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory