Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate GFF2304 PGA1_c23360 putative iron containing alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >FitnessBrowser__Phaeo:GFF2304 Length = 381 Score = 215 bits (548), Expect = 1e-60 Identities = 127/374 (33%), Positives = 193/374 (51%), Gaps = 13/374 (3%) Query: 14 GAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMSYHLFDEVFPNPTE 73 GAG I ++ A K L+VTD L L + S L+ + +F EV PNP E Sbjct: 16 GAGRIRELAEACATAGMKKPLLVTDKGLADLPVTQSTLDILEAAGLGRAMFCEVDPNPNE 75 Query: 74 ELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYSGVGKV-----KNA 128 + ++ G AAY++ + D +IAFGGGS +D K V + P + +G +A Sbjct: 76 KNLEAGVAAYKAGDHDGVIAFGGGSGLDLGKMVAFMCGQNRPVWDFEDIGDWWTRADADA 135 Query: 129 GVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVMLEIPASVTA 188 P++A+ TTAGT +E+ +VI DS K++I P ++P + + D + + +P +TA Sbjct: 136 IAPIIAVPTTAGTGSEVGRASVITDSVTHQKKIIFHPKVLPTVVICDPELTVGMPKFITA 195 Query: 189 ATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGHNLEAREQMAFGQYL 248 TG+DA H VEA+ S HP++ ALE +RL+ +LP+A DG ++EAR QM + Sbjct: 196 GTGLDAFAHCVEAFSSPHYHPMSQGIALEGMRLVKEYLPRAYADGTDIEARAQMMSAAAM 255 Query: 249 AGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFARIAQAMGV 308 AF GLG +HA++H GA N HG NA+ + V FN P RF A +G+ Sbjct: 256 GATAFQK-GLGAIHAMSHPIGALFNTHHGTTNAVCMLAVLAFNAPEIADRFKTAADYLGI 314 Query: 309 ETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADPCAPCNPRT 368 + + ++ L+ +GIP G S+LGVT+ I + AL DP NP Sbjct: 315 -------DGGFEGVCAYVQELNDSLGIPRGLSELGVTEAAIPELVKGALIDPSCGGNPVV 367 Query: 369 ASRDEVRGLYLEAL 382 + + L++ L Sbjct: 368 LDQANLTQLFMNTL 381 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 381 Length adjustment: 30 Effective length of query: 352 Effective length of database: 351 Effective search space: 123552 Effective search space used: 123552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory