Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate GFF2762 PGA1_c28050 putative sugar transport system, permease protein
Query= TCDB::Q7BSH3 (333 letters) >FitnessBrowser__Phaeo:GFF2762 Length = 353 Score = 135 bits (340), Expect = 2e-36 Identities = 93/299 (31%), Positives = 147/299 (49%), Gaps = 8/299 (2%) Query: 14 LIIVVMIVVFSTR-AADFATPGNLAGIFNDTSILIILALAQMTVILTKSIDLSVAANLAF 72 +++V+ ++VF + F +P L I I+ I+A AQ VILT IDLSV A + Sbjct: 46 IVLVLSVIVFGLLLGSKFFSPFALTLILQQVGIVGIVACAQSLVILTAGIDLSVGAIMVL 105 Query: 73 TGMAIAMMNAAHPDLPLVVLILMAVVIGACLGAINGFLVWALEIPPIVVTLGTLTIYRGM 132 + + + + LP V + ++ G G ING+LV +++PP +VTLG I Sbjct: 106 SSVVMGQFTFRY-GLPPEVAVACGLICGTICGFINGWLVARMKLPPFIVTLGMWQIVLAS 164 Query: 133 AFVLSGGAWVNAHQMT---PIFLSVPRTPVLGLPVLSWVGIIIVILMYVL---LRYTQFG 186 F+ S + + + P+ +G V ++ I +VIL+ +L LR+T +G Sbjct: 165 NFLYSANETIRSQTIAAEAPLLQLFGEKIKIGGAVFTYGVIFMVILVVLLAYVLRHTAWG 224 Query: 187 RSAYATGGNPTAAVYAGIDTGWTKFLAFVLSGALAGLASYLWVSRYAVAYVDIANGFELD 246 R YA G +P AA +G+ ++LSG + A + + R ++ Sbjct: 225 RHVYAVGDDPEAAELSGVKVTRVLISVYMLSGLICAFAGWAMIGRIGSVSPTSGQLANIE 284 Query: 247 SVAACVIGGISIAGGVGSVAGTVLGALFLGVIKNALPVIGISPFTQMAISGTVIILAVA 305 S+ A VIGGIS+ GG GS+ GT GAL +GV L ++G + G +II AVA Sbjct: 285 SITAVVIGGISLFGGRGSILGTFFGALIVGVFTLGLRLLGADAQWTYLLIGLLIIAAVA 343 Score = 24.6 bits (52), Expect = 0.004 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 79 MMNAAHPDLPLVVLILMAVVIGACLGA 105 M++ +PL+VL+L +V G LG+ Sbjct: 35 MLHVTPSLVPLIVLVLSVIVFGLLLGS 61 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 333 Length of database: 353 Length adjustment: 29 Effective length of query: 304 Effective length of database: 324 Effective search space: 98496 Effective search space used: 98496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory