Align Fructose import permease protein FrcC (characterized)
to candidate GFF2276 PGA1_c23080 ribose transport system permease protein RbsC
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__Phaeo:GFF2276 Length = 324 Score = 141 bits (356), Expect = 2e-38 Identities = 94/301 (31%), Positives = 150/301 (49%), Gaps = 8/301 (2%) Query: 52 LIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIMV 111 LI L +I F I KF + +++ AI+G++ T V+++ +DLSVG++M Sbjct: 19 LIAFALFIIGF-TIANPKFLTLDNFENVVRSSAILGVMALGVTFVVISGNLDLSVGSMMS 77 Query: 112 LSSVIMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLAS 171 S++++ + G P L++ + G + G LV +KL IVTLGM + Sbjct: 78 FSTIVVLDLHDKLG--PTLAIPAMFAMTLCLGALIGFLVGYLKLNSLIVTLGMLSAIHGL 135 Query: 172 NFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWYVLNRTAWG 231 YS + + D + FGQ +G +++ + L LL +L +T +G Sbjct: 136 TLTYSGGKNMDIAD--KEGTWFAIFGQGNILG---IQTPILIFIALAALLGIILAKTPFG 190 Query: 232 RYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTAGQFANIE 291 R VYAVG + AA +G+ R++ Y +S L A AG R T GQ +E Sbjct: 191 RKVYAVGGNGTAATFSGIRRARVVFLCYIMSALCVATAGLIQASRSMGSQNTVGQGLELE 250 Query: 292 SITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVAI 351 + AV++GG SL GG G+I + G LI+G GL L+G D Y++ ++II+AV + Sbjct: 251 VLAAVILGGASLLGGSGTIFKTVIGVLILGFIQNGLLLVGLDFSVQYVVTWIIIILAVWL 310 Query: 352 D 352 D Sbjct: 311 D 311 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 324 Length adjustment: 29 Effective length of query: 331 Effective length of database: 295 Effective search space: 97645 Effective search space used: 97645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory