Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family (characterized, see rationale)
to candidate GFF2275 PGA1_c23070 putative ribose transport system permease protein
Query= uniprot:A0A1N7UNQ5 (325 letters) >FitnessBrowser__Phaeo:GFF2275 Length = 333 Score = 157 bits (397), Expect = 3e-43 Identities = 99/288 (34%), Positives = 152/288 (52%), Gaps = 7/288 (2%) Query: 34 FSVLSDHFLSYDTFSTLANQIPDLMVLAVGMTFILIIGGIDLSVGSVLALAA-----SAV 88 FSV F+ D L Q + ++A+GMT +++ G IDLSVG++ A+ A S Sbjct: 33 FSVSDKAFMDTDNMLLLLKQSAPIGIIAMGMTIVMVNGNIDLSVGAIYAICAIILLDSMT 92 Query: 89 SVAILGWGWSVLPAA-VLGMGCAALAGTITGSITVAWRIPSFIVSLGVLEMARGVAYQMT 147 G G V+P A L + + G I G I + +FIV+LG + RG+ + Sbjct: 93 WTMFAGLGNWVIPVAWCLALLTGVVLGAINGLIVWKTGVDAFIVTLGSMLGYRGLVFMYN 152 Query: 148 GSR-TAYIGDSFAWLSNPIAFGISPSFIIALLVIIAAQLVLTRTVFGRYLIGIGTNEEAV 206 G + T+++ + + G+ + L+V +A ++ RTV GR IG N EA Sbjct: 153 GEQPTSHLNWTLVDFAEAQFLGLHTATWFLLVVTVAIWFLMNRTVHGRNAYAIGNNREAA 212 Query: 207 RLAGINPKPYKILVFSLMGLLAGVAALFQISRLEAADPNAGSGLELQVIAAVVIGGTSLM 266 AGI P+ ++ F ++G LA ++A+ S + +PN G EL VI AVV+GGT L Sbjct: 213 VNAGIRVGPHMMINFMIIGFLAALSAVVFYSESGSVNPNDGQLYELWVITAVVLGGTKLT 272 Query: 267 GGRGSVISTFFGVLIISVLAAGLAQIGATEPTKRIITGAVIVIAVVLD 314 GG GS++STF GV+ I +L GLA IGA T ++ G +++ + LD Sbjct: 273 GGAGSIVSTFGGVIAIQLLRKGLAHIGADTSTVNLVIGLILIAVLFLD 320 Lambda K H 0.324 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 333 Length adjustment: 28 Effective length of query: 297 Effective length of database: 305 Effective search space: 90585 Effective search space used: 90585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory