Align Fructokinase (EC 2.7.1.4) (characterized)
to candidate GFF2759 PGA1_c28020 fructokinase Frk
Query= reanno::Dino:3609413 (308 letters) >FitnessBrowser__Phaeo:GFF2759 Length = 323 Score = 292 bits (748), Expect = 6e-84 Identities = 165/322 (51%), Positives = 199/322 (61%), Gaps = 17/322 (5%) Query: 1 MILCAGEALIDMLPR----ALP-----DGTAGFAPVAGGAVFNTAVALGRLGADVGLVTG 51 MILC GEALIDM+P A+P D GF P GGAVFNTA+ALGRLG GL TG Sbjct: 1 MILCCGEALIDMIPAPVAGAVPVVDGADAQTGFVPHCGGAVFNTAIALGRLGQTTGLFTG 60 Query: 52 LSRDLFGEVLMTALAAADVDSDMAVLSDRPTTLAFVTLTDGHAQYAFYDENTAGRMLAPA 111 LSRDLFG+ L AL A+ VD A SD+P+TLAFV L DGHA+Y F+DEN+AG L P Sbjct: 61 LSRDLFGQQLAAALVASHVDHGFAERSDQPSTLAFVHLRDGHAEYHFFDENSAGASLRPD 120 Query: 112 DMPDPGPEVGTLFFGGISLAVEPCAAAYEALCLKAAAGRVVMLDPNIRPGFIKDETTFRA 171 +P+ +V LFFGGISL A Y AL + R++M+DPN+R GF KDE +R+ Sbjct: 121 RLPELSADVDALFFGGISLCNGAAAETYAALAARERGRRIIMIDPNVRAGFAKDEAAYRS 180 Query: 172 RIDRMLAVTDIVKVSDEDLAWLMGPGD------LAESAAALRARGPAVVCVTRGGAGVEA 225 R+ M+A IVKVSDEDL W+ PGD + + GP +V +T G G + Sbjct: 181 RLAAMVARAGIVKVSDEDLHWIY-PGDAPIEEKIRQILTGEAGMGPGLVILTLGSKGAKG 239 Query: 226 HTATGIT-HVAAEAVEVVDTVGAGDTFNAGFLAGLAEAGALDKDRLRALDAPVLTSALRL 284 +G T V A+ V DTVGAGDTFNAGF+A EAG L +D L L Sbjct: 240 FLRSGPTVEVPAQVAVVADTVGAGDTFNAGFMAAATEAGVLADAASGEMDPEQLRVCLGY 299 Query: 285 GAQAAAITVSRAGANPPWRDEL 306 GA+AAA+TVSR GANPPWRDEL Sbjct: 300 GARAAAVTVSRPGANPPWRDEL 321 Lambda K H 0.320 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 323 Length adjustment: 27 Effective length of query: 281 Effective length of database: 296 Effective search space: 83176 Effective search space used: 83176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory