Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate GFF2277 PGA1_c23090 putative acetoin(diacetyl) reductase
Query= reanno::Phaeo:GFF1301 (257 letters) >FitnessBrowser__Phaeo:GFF2277 Length = 263 Score = 182 bits (463), Expect = 5e-51 Identities = 107/259 (41%), Positives = 147/259 (56%), Gaps = 6/259 (2%) Query: 1 MKRLSGKRALITGAARGIGAAFAEAYANEGARVVIADIDTARAEATAA----QIGAAAIA 56 M R+SG+ ++TGAA+GIG A AEA +EGA V ADI+ + A+ G + + Sbjct: 1 MGRVSGRSCIVTGAAQGIGRAIAEALLDEGASVCFADINGIKVAEVASLNRSTHGESRVT 60 Query: 57 -VELDVTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGT 115 ++DVTD+ ++ + TV FG LD+ NNA V ++VT E ++ D+N G Sbjct: 61 HAQVDVTDRETVRALIDHTVAMFGKLDVKFNNAGVNKPMNFLDVTEENWRFVNDVNGLGC 120 Query: 116 LFMMQAAAQQMITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHG 175 L MQ AA+Q I QGT GKIIN AS A R+G V+ YCA+K V++LTQS +L H Sbjct: 121 LIGMQEAAKQFIRQGTFGKIINTASIASRQGFDNVAPYCASKFGVVALTQSGARDLAKHN 180 Query: 176 INVNAIAPGVVDGEHWDGVDAFFAKY-EGKAPGQKKAEVAQSVPYGRMGTAADLTGMAVF 234 I V APGVVD E W+ VD + PGQ E + + GR+ D+TG F Sbjct: 181 ITVTGFAPGVVDTEMWEQVDQDLMDIGAAERPGQAMEEFSADILKGRVAKPQDITGTTTF 240 Query: 235 LASEDADYVVAQTYNVDGG 253 LA+ D+DY+ Q +DGG Sbjct: 241 LAAPDSDYMTGQIVMIDGG 259 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 263 Length adjustment: 24 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory