Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate GFF1645 PGA1_c16680 sugar ABC transporter, ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__Phaeo:GFF1645 Length = 355 Score = 360 bits (924), Expect = e-104 Identities = 198/363 (54%), Positives = 248/363 (68%), Gaps = 13/363 (3%) Query: 1 MTGLLLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDM 60 M + L+D+ K YGAV+V+ I+LDI++GEF+V VGPSGCGKSTLLRMIAGLE IT GD Sbjct: 1 MARIELRDVAKRYGAVEVLRDINLDIQDGEFIVLVGPSGCGKSTLLRMIAGLEPITSGDF 60 Query: 61 FIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADM 120 IDG+R+NDV P R IAMVFQSYALYPHM V NM F M I ++ EE RV AA+ Sbjct: 61 EIDGQRMNDVRPRDRDIAMVFQSYALYPHMDVARNMGFSMEIRKDPAEERRSRVARAAET 120 Query: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLS 180 L L+ +DRLPKALSGGQRQRVA+GRAI R+P+ FLFDEPLSNLDAALRV R+EIA+L Sbjct: 121 LGLSSLVDRLPKALSGGQRQRVAMGRAIIRDPRAFLFDEPLSNLDAALRVEMRLEIARLH 180 Query: 181 ERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAM 240 +++ TMIYVTHDQVEA+TLADRIVVL+ G I+QVG+PLELYERPAN FVA+FIGSP M Sbjct: 181 KQLG-ATMIYVTHDQVEALTLADRIVVLNGGDIQQVGSPLELYERPANKFVAQFIGSPTM 239 Query: 241 NVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDFLFEG 300 N++P + A+G V G +TLD + + G+RPE L V E + Sbjct: 240 NILPVSGAASG----VMATNGMMLTLD---HMHDTAAAVELGIRPEHLDVVEPGEGHLIA 292 Query: 301 TVSIVEALGEVTLLY--IEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFDTNGQ 358 +VE LG T +Y ++GL P++ + G V G+++ H+FD G Sbjct: 293 VADVVERLGSDTNIYAKVDGL---GPLMVRKHGNVPVRSGERLGLRVQAQNAHIFDDRGI 349 Query: 359 SYR 361 + R Sbjct: 350 ALR 352 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 355 Length adjustment: 29 Effective length of query: 333 Effective length of database: 326 Effective search space: 108558 Effective search space used: 108558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory