Align UTP--glucose-1-phosphate uridylyltransferase; Alpha-D-glucosyl-1-phosphate uridylyltransferase; General stress protein 33; GSP33; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase; EC 2.7.7.9 (characterized)
to candidate GFF3395 PGA1_c34480 UTP--glucose-1-phosphate uridylyltransferase CelA
Query= SwissProt::Q05852 (292 letters) >FitnessBrowser__Phaeo:GFF3395 Length = 297 Score = 285 bits (729), Expect = 9e-82 Identities = 142/285 (49%), Positives = 200/285 (70%), Gaps = 4/285 (1%) Query: 2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSK 61 +KV KAI P AGLGTRFLPATK++PKE++ +VD+P +QY I+EA EAGI++ I VT + K Sbjct: 3 RKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSRGK 62 Query: 62 RAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLAD--IHYIRQKEPKGLGHAVWCARN 119 A+ED+FD+SP LE+ L +KGK +LL+ + KA+N+ I YIRQ + GLGHAVWCAR Sbjct: 63 GALEDYFDHSPMLEQELRKKGKDDLLD-ILKATNMDSGAIAYIRQHQALGLGHAVWCARR 121 Query: 120 FIGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSE 179 I +EPFAV+L DD++ AETP L+Q+++ YE+T +++ +VP E+T YG++D Sbjct: 122 LIANEPFAVILPDDVIAAETPCLKQMVEAYEETGGNMVAAMEVPPEQTSSYGVLDVRDDM 181 Query: 180 GRRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAI-QKLN 238 G V VEKP APSNLA++GRY+ P + L +++ GAGGEIQLTDAI + + Sbjct: 182 GSVVSVNGMVEKPKAEEAPSNLAVIGRYILAPSVLRNLNKKKQGAGGEIQLTDAIAEDIA 241 Query: 239 EIQRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFM 283 V+ Y F G+R+D G K GF+ T+ FA+ +ELRD L+ ++ Sbjct: 242 ADVPVYGYRFRGQRFDCGSKAGFLQATVAFALAREELRDDLMCYI 286 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 297 Length adjustment: 26 Effective length of query: 266 Effective length of database: 271 Effective search space: 72086 Effective search space used: 72086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate GFF3395 PGA1_c34480 (UTP--glucose-1-phosphate uridylyltransferase CelA)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.27891.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-105 338.0 0.0 2.5e-105 337.8 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3395 PGA1_c34480 UTP--glucose-1-phosp Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3395 PGA1_c34480 UTP--glucose-1-phosphate uridylyltransferase CelA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.8 0.0 2.5e-105 2.5e-105 1 261 [] 5 267 .. 5 267 .. 0.97 Alignments for each domain: == domain 1 score: 337.8 bits; conditional E-value: 2.5e-105 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleakle 76 + ka++P+aGlGtr+LPatk++Pke++++vd+Pl+qy+++ea eaGi+e ++vt+r+k a+ed+fD+s le++l+ lcl|FitnessBrowser__Phaeo:GFF3395 5 VTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSRGKGALEDYFDHSPMLEQELR 80 679************************************************************************* PP TIGR01099 77 kknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeeealkqlielyektga 151 kk+k++ll+ +++ i y+rq++a GLGhav++a++l+++epfav+l+Dd++++e+++lkq++e+ye+tg lcl|FitnessBrowser__Phaeo:GFF3395 81 KKGKDDLLDILKATNMDsGAIAYIRQHQALGLGHAVWCARRLIANEPFAVILPDDVIAAETPCLKQMVEAYEETGG 156 ***********98764449********************************************************* PP TIGR01099 152 siiaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkggeiql 227 +++a +evp e++s+YGv+d++ ++++v+ +vekPk+eeapsnla++GrY+l p++ + l++ k+G+ggeiql lcl|FitnessBrowser__Phaeo:GFF3395 157 NMVAAMEVPPEQTSSYGVLDVRDDMGSVVSVNGMVEKPKAEEAPSNLAVIGRYILAPSVLRNLNKKKQGAGGEIQL 232 **************************************************************************** PP TIGR01099 228 tDalrllleke.evlavklkgkryDvGdklgylka 261 tDa++ + ++ v++++++g+r+D+G+k g+l+a lcl|FitnessBrowser__Phaeo:GFF3395 233 TDAIAEDIAADvPVYGYRFRGQRFDCGSKAGFLQA 267 ****987765527********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.47 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory