GapMind for catabolism of small carbon sources

 

Aligments for a candidate for thuG in Phaeobacter inhibens BS107

Align Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component

Query= TCDB::Q72H66
         (280 letters)



>lcl|FitnessBrowser__Phaeo:GFF1646 PGA1_c16690 binding
           protein-dependent transport system, inner membrane
           component
          Length = 283

 Score =  174 bits (441), Expect = 2e-48
 Identities = 90/267 (33%), Positives = 142/267 (53%), Gaps = 2/267 (0%)

Query: 14  YLLVVFVVVYSVFPFYWAVISSFKPSDALFSPDPSFLPVPFTLEHYENVFLQANFGRNLL 73
           Y  + F + +++FP YW +  +  P   +FS     LP   T E++  V  +  F     
Sbjct: 19  YAAIAFYLGFALFPLYWLMKIAITPDALIFSEGTRMLPSAVTFENFATVLFETEFLAYFR 78

Query: 74  NSLIVAGGATLLSLVLGVLAAYALGRLPFPPKNAVMYIVLSMTMFPQIAVLGGLFLLLRQ 133
           NSL V+ G    + ++   A YA  R  F  K  ++ ++L   MFP + ++  ++ ++  
Sbjct: 79  NSLTVSLGTAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMIIAPIYKIVAD 138

Query: 134 TGLFNTHLGLILTYLLFTLPFTVWVLVGYFRGLPRELEEAAYVDGATPLQTLLKVMLPLT 193
            GL N+   LI+ Y  F +PF  +++  +F G+P++LEEAA +DG +  Q L  V+ PLT
Sbjct: 139 LGLLNSLTSLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQALRTVVFPLT 198

Query: 194 GPGLVTTGLLAFIAAWNEYLFALTFTVGDSVKTVPPAIASFGGATPFEIPWGSIMAASVV 253
            PGL  T    F AAW+E LFAL     +   T P  + +F   + F + WG +MAA V+
Sbjct: 199 LPGLGATLGFVFTAAWSELLFALMLISKNDAMTFPVGLLTF--VSKFSVDWGQMMAAGVL 256

Query: 254 VTVPLVVLVLVFQQRIVAGLTAGAVKG 280
             VP  +  +  Q+ +V GLT+GAVKG
Sbjct: 257 ALVPSCLFFIFIQRYLVQGLTSGAVKG 283


Lambda     K      H
   0.329    0.145    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 140
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 280
Length of database: 283
Length adjustment: 26
Effective length of query: 254
Effective length of database: 257
Effective search space:    65278
Effective search space used:    65278
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory