Align ABC transporter (characterized, see rationale)
to candidate GFF729 PGA1_c07440 ABC transporter, ATP binding protein
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__Phaeo:GFF729 Length = 353 Score = 338 bits (868), Expect = 1e-97 Identities = 189/353 (53%), Positives = 237/353 (67%), Gaps = 10/353 (2%) Query: 1 MIKLKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDL 60 M + L K+ G ++++ DV L I GEF VFVGPSGCGKSTLLR+IAGL+ G++ Sbjct: 1 MTGVTLAKAVKKYGDVQVIHDVDLSIDDGEFCVFVGPSGCGKSTLLRMIAGLEETSSGNI 60 Query: 61 LIDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQI 120 I R V L+ +RGV MVFQSYALYPHM+V DN+ FGLK+ K +RE+V + ++I Sbjct: 61 HIGDRDVTRLDAADRGVAMVFQSYALYPHMTVEDNMGFGLKMNGHPKEKIREKVAEASRI 120 Query: 121 LQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLH 180 L+LD L+RKPK LSGGQRQRVA+GRA+ R P++ LFDEPLSNLDA LRV MR EIARLH Sbjct: 121 LKLDDYLKRKPKALSGGQRQRVAIGRAIVRGPEVFLFDEPLSNLDAELRVDMRVEIARLH 180 Query: 181 DRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMN 240 +G+TMIYVTHDQVEAMTLADKIVVL GRVEQVGSP ELY P +RFVAGF+GSP MN Sbjct: 181 KEIGATMIYVTHDQVEAMTLADKIVVLRAGRVEQVGSPMELYANPDNRFVAGFIGSPSMN 240 Query: 241 FLSARLQTPGET--SLVDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHVSLKAADGTAGV 298 FL +Q G +L + V +LP D G+ + LG+RP+H+S+ AAD + + Sbjct: 241 FLEGTVQGDGVVVPALENRRVATSVALPAD------GSKVLLGLRPQHLSVTAAD--SSL 292 Query: 299 VVTAVEYLGSETYVHLETGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLFD 351 V+ E LG +Y +L T E LI G V L D + ++FD Sbjct: 293 VLDLRERLGGVSYDYLSTPTGEKLIVETRGDEALPEGTAVALGFDDADAYIFD 345 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 353 Length adjustment: 30 Effective length of query: 351 Effective length of database: 323 Effective search space: 113373 Effective search space used: 113373 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory