Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate GFF2298 PGA1_c23300 putative sarcosine dehydrogenase
Query= curated2:Q2RH46 (366 letters) >FitnessBrowser__Phaeo:GFF2298 Length = 815 Score = 169 bits (428), Expect = 2e-46 Identities = 112/352 (31%), Positives = 175/352 (49%), Gaps = 26/352 (7%) Query: 5 KKTPLYGEHVAAGAKMVEFGGWLMPVQYS---------------------SIIEEHQRVR 43 +K+PLY GA E GW P ++ ++ EH+ R Sbjct: 421 RKSPLYDTLKNKGACFGEKLGWERPNWFADATRGETPQDLYSFGRQNWFDAVGREHKAAR 480 Query: 44 NCAGLFDVSHMGEITIKGPDALALVQKLLTNDADRATGDRVIYSPMCYPDGGVVDDLLVY 103 A LFD + + T+KGPDALA + + ND D+ G +IY+ M GG+ DL V Sbjct: 481 EAAVLFDQTSFAKFTLKGPDALAAMNWICANDVDKPVGS-LIYTQMLNDKGGIECDLTVG 539 Query: 104 PRGEGEYLLVVNAGNIDKDFAWIQENA-SGFRVEVSNISAATAQLALQGPRALEILRPLT 162 + E+ +V G + DF WI+ N G ++ +I+++ A L+L GP+A +IL +T Sbjct: 540 RVAQDEFYIVTGTGYVTHDFDWIRRNIPEGMNCQLFDITSSNAVLSLMGPKARDILAAVT 599 Query: 163 RVDLASLGYYRWTEGQVLGVHCLIS--RTGYTGEDGFELYFEAAAAPTMWRNILAAGREA 220 R D+++ G+ T + C + R Y GE G+EL+ A T++ ++ G+ Sbjct: 600 RDDVSNDGFQFGTIRTIGIAGCPVQALRVTYVGELGWELHLPVEYAQTVYAALMGVGQPL 659 Query: 221 GLVPAGLGARDTLRLEAALPLYGHELGPDISPLEAGLHRFVRLEKG-EFNGREALAAQRE 279 GLV AG A ++LRLE +G ++GPD +P EAGL V+L K F GR A A++ Sbjct: 660 GLVDAGYRAIESLRLEKGYRAWGSDIGPDHTPFEAGLGWAVKLRKKIAFKGRAAAEARKA 719 Query: 280 AGVRRQLVGLTMIDRGIPRPEYPVLAAGKEIGYVTSGSLAPTLGQNIALALV 331 GV++ L T + + GK +G++TSG T+GQ+I + Sbjct: 720 GGVKKMLACFTTDPGVVLMGRETIYRNGKRVGWLTSGGYGYTVGQSIGYGYI 771 Lambda K H 0.320 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 828 Number of extensions: 49 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 815 Length adjustment: 35 Effective length of query: 331 Effective length of database: 780 Effective search space: 258180 Effective search space used: 258180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory