Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate GFF3865 PGA1_78p00290 aminomethyltransferase GcvT
Query= reanno::WCS417:GFF4369 (374 letters) >FitnessBrowser__Phaeo:GFF3865 Length = 365 Score = 346 bits (888), Expect = e-100 Identities = 178/371 (47%), Positives = 244/371 (65%), Gaps = 7/371 (1%) Query: 3 TETLLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHLHTRDQAGLFDVSHMGQIRL 62 T+ +TPL+ LH+ LG +MV FAG++MPVQYP+G+M EH R++A LFDVSHMGQ+ L Sbjct: 2 TDAPKRTPLYDLHVALGGKMVDFAGWEMPVQYPMGIMGEHKQCREKAALFDVSHMGQVIL 61 Query: 63 TGANAAKALETLVPVDILDLPVGMQRYAMFTNDQGGILDDLMVANLGNEELFLVVNAACK 122 G N + LE + P L G RY FTN+ GGI+DDL+V+N G + F+VVNAA + Sbjct: 62 RGDNVGEKLEAICPQAYATLKEGKARYGFFTNEDGGIMDDLIVSNAG-DHYFVVVNAALR 120 Query: 123 DQDLAHLRQHIGDQCTIEPLFEERALLALQGPAAVKVLARLAPEVTKMTFMQFATLRLLG 182 QD+ H++ H+ D + +F+ RAL+A+QGPAA V+ L P +M FM+ + G Sbjct: 121 HQDIPHMKAHL-DGVEVTEIFD-RALVAVQGPAAENVVGDLCPAAREMKFMETIVADIDG 178 Query: 183 VDCYVSRSGYTGEDGFEISVPAANAESLARSLLAETEVQAIGLGARDSLRLEAGLCLYGH 242 V+C +SR GYTGEDG+EIS+P A+AE + + LA + + GLGARDSLRLEAGLCLYG+ Sbjct: 179 VECRLSRLGYTGEDGYEISIPDADAERITKLFLAHDDCEPAGLGARDSLRLEAGLCLYGN 238 Query: 243 DMNTDTTPIEASLLWAISKARRADGARAGGFPGADTIFTQQQAGVSRKRVGLLPQERTPV 302 D++ T+PIEASL WAI K R+ + GGFPGAD I + G ++K VG+ P R P Sbjct: 239 DIDQSTSPIEASLAWAIQKRRKEE----GGFPGADRIRKELADGAAKKLVGIKPSGRAPA 294 Query: 303 REGAQIVDADGTVIGSVCSGGFGSTLGGPLAMGYLDSAFIALDTEVSALVRGKKVPLRVS 362 R+ +I A+G IG + SG FG T+GGP+AMGY+ + +V ++RGK + Sbjct: 295 RQHVEIQCAEGNTIGEITSGCFGPTVGGPVAMGYVAAPHGKAGEQVKLIIRGKAHDAEIV 354 Query: 363 KMPFVPQRYYR 373 +PFV Q Y R Sbjct: 355 ALPFVTQNYKR 365 Lambda K H 0.321 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 365 Length adjustment: 30 Effective length of query: 344 Effective length of database: 335 Effective search space: 115240 Effective search space used: 115240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF3865 PGA1_78p00290 (aminomethyltransferase GcvT)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.22702.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-104 333.5 0.0 8.4e-104 333.3 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3865 PGA1_78p00290 aminomethyltransfe Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3865 PGA1_78p00290 aminomethyltransferase GcvT # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 333.3 0.0 8.4e-104 8.4e-104 2 361 .. 6 360 .. 5 361 .. 0.95 Alignments for each domain: == domain 1 score: 333.3 bits; conditional E-value: 8.4e-104 TIGR00528 2 krtpLydlhtelggklvdfaGwelPvqy.kslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvdaL 76 krtpLydlh+ lggk+vdfaGwe+Pvqy +++ eh+ r+ka lfDvshmg+v l+G+++ + L+ + ++ + L lcl|FitnessBrowser__Phaeo:GFF3865 6 KRTPLYDLHVALGGKMVDFAGWEMPVQYpMGIMGEHKQCREKAALFDVSHMGQVILRGDNVGEKLEAICPQAYATL 81 89**************************55889******************************************* PP TIGR00528 77 tkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllalqGPkak 152 +Gka+y + n +GG++DDliv + g+ + +vvnaa +++D ++k hl++ ++ + + +l+a+qGP a+ lcl|FitnessBrowser__Phaeo:GFF3865 82 KEGKARYGFFTNEDGGIMDDLIVSNAGDH--YFVVVNAALRHQDIPHMKAHLDGV-EVTE-IFDRALVAVQGPAAE 153 *************************9998..99*******************864.4444.44569********** PP TIGR00528 153 tiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkPiGLgarDtL 228 +++ dl + + ++k + + a++ + ++ ++r GytGedG+ei++++ +a + k ++++ P GLgarD+L lcl|FitnessBrowser__Phaeo:GFF3865 154 NVVGDLCPA-AREMKFMETI-VADIDGVECRLSRLGYTGEDGYEISIPDADAERITKLFLAHDDCEPAGLGARDSL 227 *****9975.6789988888.9****************************************************** PP TIGR00528 229 rleagmaLyGqeldeeitPleaglgwvvkker.kksdfiGravleeqkengtekklvGlemlekgiarnelkvllt 303 rleag++LyG+++d++++P+ea+l w+++k r ++ f G + + + ++g+ kklvG++ + ar+++++ + lcl|FitnessBrowser__Phaeo:GFF3865 228 RLEAGLCLYGNDIDQSTSPIEASLAWAIQKRRkEEGGFPGADRIRKELADGAAKKLVGIKPSGRAPARQHVEIQCA 303 *****************************99845679*************************************** PP TIGR00528 304 ngekevGivtsGtlsPtLgknialayvdkelekiGtklevevrnklvkikvvkklfvr 361 +g +++G +tsG + Pt+g +a++yv k G++++ +r+k ++++v +fv lcl|FitnessBrowser__Phaeo:GFF3865 304 EG-NTIGEITSGCFGPTVGGPVAMGYVAAPHGKAGEQVKLIIRGKAHDAEIVALPFVT 360 **.899************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.49 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory