Align methylmalonyl-CoA mutase (subunit 2/2) (EC 5.4.99.2) (characterized)
to candidate GFF373 PGA1_c03840 methylmalonyl-CoA mutase large subunit
Query= BRENDA::O74009 (563 letters) >FitnessBrowser__Phaeo:GFF373 Length = 655 Score = 369 bits (946), Expect = e-106 Identities = 205/490 (41%), Positives = 301/490 (61%), Gaps = 13/490 (2%) Query: 81 MYRGRIWTMRQYAGYATAEESNKRYKYLLSQGQTGLSVAFDLPTQLGYDSDHPLAEGEVG 140 M + R W +R YAG++TA SN Y+ L++GQTGLSVAFDLPTQ GYDSDH LA GEVG Sbjct: 4 MQKDRPWLIRTYAGHSTASASNALYRANLAKGQTGLSVAFDLPTQTGYDSDHVLARGEVG 63 Query: 141 KVGVAIDSLWDMRILFDGIPLDKVSTSMTINSTAANLLAMYILVAEEQGVSQEKLRGTVQ 200 KVGV + L DMR LFD IPL++++TSMTIN+TA LL++YI VAEEQG KL+GTVQ Sbjct: 64 KVGVPVCHLGDMRSLFDQIPLEQMNTSMTINATAPWLLSLYIAVAEEQGADVSKLQGTVQ 123 Query: 201 NDILKEYIARGTYIFPPQPSMRLTTDIIMYCAENVPKWNPISISGYHIREAGANAVQEVA 260 ND++KEY++RGTY+ PP+PS+++ D+ YC N PKWNP+++ YH++EAGA QE+A Sbjct: 124 NDLIKEYLSRGTYVCPPKPSLKMIADVAEYCYTNAPKWNPMNVCSYHLQEAGATPEQELA 183 Query: 261 FTLADGIEYVKAVIER--GMDVDKFAPRLSFFFAAHNNFLEEIAKFRAARRLWAYIMKEW 318 F LA + + R D R+SFF A F+ E+ K RA LW I ++ Sbjct: 184 FALATAQAVLDELKPRITPEDFPAMVGRISFFVNAGIRFVTEMCKMRAFVDLWDEICRDR 243 Query: 319 FNAKNPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVL---GGTQSLHTNSYDEA 375 + ++P+ R+ Q LT QQPENN+ R+ I+ LA L +++ +++EA Sbjct: 244 YGVEDPKFRRFRYGVQVNSLGLTEQQPENNVYRILIEMLAVTLSKKARARAVQLPAWNEA 303 Query: 376 LSLPTEKSVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYIEKIQKMG 435 L LP + ++R QQI+AYE+ +++ D G ++ + + A + ++ MG Sbjct: 304 LGLPRPWDQQWSMRMQQILAYETDLLEYGDLFDGNPAVDAKVEDLKTGARAELANLESMG 363 Query: 436 GMMRAIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAFVTDEPIEVE-----ILKVDPS 490 G + +IE Y++ + ++ + IE+ + I+VGVN + EP ++ I+ VDP+ Sbjct: 364 GAVASIE--YMKGRLVDSNAERLNRIEKNETIVVGVNKWTEGEPSPLQTEDGGIMVVDPA 421 Query: 491 IREKQIERLKKLRSERDNKKVQEALDKLRNAAEKEDENLMPYIIEAHRHLATLQEVTDVL 550 + ++QI RL RS RD+ VQ AL LR AA+ D N+MP I A + T E + + Sbjct: 422 VEQEQINRLDDWRSGRDDDAVQSALAALRAAAQNGD-NIMPPSIAAAKAGVTTGEWAEEM 480 Query: 551 REIWGEYRAP 560 R+++G YR P Sbjct: 481 RKVYGTYRGP 490 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 827 Number of extensions: 42 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 563 Length of database: 655 Length adjustment: 37 Effective length of query: 526 Effective length of database: 618 Effective search space: 325068 Effective search space used: 325068 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory