GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Phaeobacter inhibens BS107

Align 4-trimethylammoniobutyraldehyde dehydrogenase (EC 1.2.1.47) (characterized)
to candidate GFF2135 PGA1_c21670 betaine aldehyde dehydrogenase BetB

Query= BRENDA::P49189
         (494 letters)



>lcl|FitnessBrowser__Phaeo:GFF2135 PGA1_c21670 betaine aldehyde
           dehydrogenase BetB
          Length = 485

 Score =  486 bits (1250), Expect = e-141
 Identities = 255/473 (53%), Positives = 323/473 (68%), Gaps = 9/473 (1%)

Query: 24  DASGTE-KAFEPATGRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAAR 82
           D +GT       ATG  IAT   +    V  A+  AKAA K W++ +G ER RIL  AA 
Sbjct: 20  DTAGTPIPVIYAATGEQIATVHAATPAIVEQALSTAKAAQKAWARMTGTERGRILRRAAD 79

Query: 83  IIREREDEIATMECINNGKSIFEARL-DIDISWQCLEYYAGLAASMAGEHIQLPGGSFGY 141
           I+RER  +++ +E  + GK + E  + D       LEY+ GLAAS+ GEHI L G  + Y
Sbjct: 80  IMRERNHDLSVLETYDTGKPLQETLVADATSGADALEYFGGLAASLTGEHIPL-GEDWVY 138

Query: 142 TRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGV 201
           T+RE LG+CVGIGAWNYP QIA WK APALACGN+MVFKPS  TP+ AL +AEI  EAG 
Sbjct: 139 TKREALGLCVGIGAWNYPTQIACWKGAPALACGNSMVFKPSETTPLCALKVAEILIEAGA 198

Query: 202 PPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPL 261
           P G+FNVVQG    G  L   P V KVS TGSVPTG K+   +A+G+K VT+ELGGKSPL
Sbjct: 199 PAGVFNVVQGMGEVGGALVTDPRVDKVSLTGSVPTGKKVYAAAAEGMKHVTMELGGKSPL 258

Query: 262 IIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPL 321
           IIF D D++NAV GA+  NF + GQVC NGTRVFVQK I +KF   + ++T    +GDP+
Sbjct: 259 IIFDDADIDNAVGGAINGNFYSSGQVCSNGTRVFVQKGIKEKFLARLAERTGNAILGDPM 318

Query: 322 LEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNC 381
            E T  GP++    +  VLG+++  KE+GA+++CGG           DGY++ P V  + 
Sbjct: 319 DEATSFGPMVTENQMNIVLGYIEKGKEEGARLICGG------RRADMDGYFIEPTVFADV 372

Query: 382 RDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAG 441
            DDMT  +EEIFGPVMS+L FDTE EV+ RANDT FGL+AGVFT+D  RAHRV+  L+AG
Sbjct: 373 TDDMTIAREEIFGPVMSVLDFDTEEEVVARANDTEFGLSAGVFTKDFTRAHRVIGNLEAG 432

Query: 442 TCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF 494
           +CFIN+YN +PVE PFGG K SG GREN +  I+++SQ+K+V V MGDVE+AF
Sbjct: 433 SCFINSYNDAPVEAPFGGVKASGVGRENSKEAIKHFSQVKSVYVRMGDVEAAF 485


Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 704
Number of extensions: 37
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 494
Length of database: 485
Length adjustment: 34
Effective length of query: 460
Effective length of database: 451
Effective search space:   207460
Effective search space used:   207460
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory