Align thymidine phosphorylase (EC 2.4.2.4) (characterized)
to candidate GFF1179 PGA1_c11940 thymidine phosphorylase DeoA
Query= BRENDA::Q7CP66 (440 letters) >FitnessBrowser__Phaeo:GFF1179 Length = 436 Score = 392 bits (1008), Expect = e-114 Identities = 212/437 (48%), Positives = 284/437 (64%), Gaps = 4/437 (0%) Query: 4 AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMAM 63 A+ II R G SD ++R+F G+ + T+S+ Q A AM + + + R +LT+AM Sbjct: 3 ARAIIASLRRGDTPSDADLRWFAEGLANGTVSDAQAGAFAMAVCLQGLGVEARGALTLAM 62 Query: 64 RDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGT 123 RDSG VL W +L+GP++DKHSTGGVGD SL+L P +A CG YVPMISGRGLGHTGGT Sbjct: 63 RDSGDVLRW---DLDGPVLDKHSTGGVGDCVSLLLAPALAECGAYVPMISGRGLGHTGGT 119 Query: 124 LDKLEAIPGFDIFPDDNRFREIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSIPLI 183 LDK+EAIPG I + ++Q VG AI+G T+ +APADKR YA RD+TATVDS+ LI Sbjct: 120 LDKMEAIPGVSIQVSEQDLVAMMQGVGCAIVGATAQIAPADKRLYAIRDVTATVDSLDLI 179 Query: 184 TGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLTDMN 243 T SIL+KKLA DALV+DVK+GSGAFM T E +EALA ++ AN AG RT+AL+TDMN Sbjct: 180 TASILSKKLAASTDALVLDVKIGSGAFMKTLEEAEALALSLTETANAAGCRTSALITDMN 239 Query: 244 QVLASSAGNAVEVREAVQFLTG-EYRNPRLFDVTMALCVEMLISGQLAKDDAEARAKLQA 302 Q LA + GNA+EV E ++ LTG + L ++T +L G LA D ++ Sbjct: 240 QPLAPALGNALEVAEVMRVLTGVSGQGGALTELTAEQGGVLLAHGGLAADAEAGAEMIRK 299 Query: 303 VLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALGMA 362 + +G AE F RMVAA G SDF E + LPTA + + + + G++SA+D ALG+A Sbjct: 300 AIASGAVAERFARMVAAMGGSSDFAETWQTILPTAPVQRRIKVEQTGYVSAIDGEALGLA 359 Query: 363 VVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAAII 422 VV +GGGR SD +D +VG +++ LG + L ++HA DEA+ A ++AA Sbjct: 360 VVQLGGGRMIESDVVDPAVGLSELTPLGQKLSVGDQLGIVHAADEAAADVAETRLRAAYQ 419 Query: 423 LDDKAPASTPSVYRRIT 439 L D AP P +Y+RI+ Sbjct: 420 LSDAAPDLPPLIYKRIS 436 Lambda K H 0.319 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 440 Length of database: 436 Length adjustment: 32 Effective length of query: 408 Effective length of database: 404 Effective search space: 164832 Effective search space used: 164832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate GFF1179 PGA1_c11940 (thymidine phosphorylase DeoA)
to HMM TIGR02644 (pdp: pyrimidine-nucleoside phosphorylase (EC 2.4.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02644.hmm # target sequence database: /tmp/gapView.2681.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02644 [M=417] Accession: TIGR02644 Description: Y_phosphoryl: pyrimidine-nucleoside phosphorylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-140 452.6 2.4 7e-140 452.4 2.4 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1179 PGA1_c11940 thymidine phosphoryl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1179 PGA1_c11940 thymidine phosphorylase DeoA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 452.4 2.4 7e-140 7e-140 3 416 .. 5 420 .. 3 421 .. 0.97 Alignments for each domain: == domain 1 score: 452.4 bits; conditional E-value: 7e-140 TIGR02644 3 eiiekKrdgkklseeeinflingytkgeiadyQisallmaiyfkgldkeEtlalTkamvesGevldlselkkikvD 78 ii r+g++ s+++++++ +g+++g+++d Q+ a++ma+ ++gl e alT am++sG+vl + +l++++ D lcl|FitnessBrowser__Phaeo:GFF1179 5 AIIASLRRGDTPSDADLRWFAEGLANGTVSDAQAGAFAMAVCLQGLGVEARGALTLAMRDSGDVLRW-DLDGPVLD 79 699999************************************************************9.69****** PP TIGR02644 79 KHStGGvGDkvsLvlaPlvaalgvkvaklSGRgLghTGGTlDKLesipGfktelseeefieivkkvglaiigqtkd 154 KHStGGvGD vsL+laP +a +g++v+++SGRgLghTGGTlDK+e+ipG+++++se++++++++ vg+ai+g+t++ lcl|FitnessBrowser__Phaeo:GFF1179 80 KHSTGGVGDCVSLLLAPALAECGAYVPMISGRGLGHTGGTLDKMEAIPGVSIQVSEQDLVAMMQGVGCAIVGATAQ 155 **************************************************************************** PP TIGR02644 155 lapaDkklYalRdvtgTvdslpLiasSilsKKlaagadalvlDvkvGkGaFmktleeakeLakelveigkkagrkv 230 +apaDk+lYa+Rdvt+Tvdsl Li++SilsKKlaa +dalvlDvk+G+GaFmktleea++La +l e +++ag ++ lcl|FitnessBrowser__Phaeo:GFF1179 156 IAPADKRLYAIRDVTATVDSLDLITASILSKKLAASTDALVLDVKIGSGAFMKTLEEAEALALSLTETANAAGCRT 231 **************************************************************************** PP TIGR02644 231 valltdmnepLgkaiGNalEvkeavevLkge.gpa..dlkelvlalaaemlllaklakteeeakekleevlesgka 303 +al+tdmn+pL+ a+GNalEv+e++ vL+g g + l+el+++ + +l++ +la + e + e+++++++sg lcl|FitnessBrowser__Phaeo:GFF1179 232 SALITDMNQPLAPALGNALEVAEVMRVLTGVsG-QggALTELTAEQGGVLLAHGGLAADAEAGAEMIRKAIASGAV 306 ******************************963.446*************************************** PP TIGR02644 304 lekfkefveaqgGdle.vlkeekklakakkkeevkaeksgvieeidaeelgliavelgaGRakkedkidleaGiel 378 +e+f+++v+a gG + ++ ++ l++a ++++k e+ g+++ id e+lgl++v+lg+GR+ ++d +d+++G++ lcl|FitnessBrowser__Phaeo:GFF1179 307 AERFARMVAAMGGSSDfAETWQTILPTAPVQRRIKVEQTGYVSAIDGEALGLAVVQLGGGRMIESDVVDPAVGLSE 382 ****************5555677789999*********************************************** PP TIGR02644 379 ekkvgdkvkkgdllltlyssdeekaeeaakalkkaiki 416 + g+k+++gd+l +++ de+ a+ a+++l++a+++ lcl|FitnessBrowser__Phaeo:GFF1179 383 LTPLGQKLSVGDQLGIVHAADEAAADVAETRLRAAYQL 420 ********************************999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (436 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 9.68 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory