Align ethanolamine utilization protein eutD (characterized)
to candidate GFF2839 PGA1_c28850 phosphate actetyl/butyryl transferase
Query= CharProtDB::CH_024378 (338 letters) >FitnessBrowser__Phaeo:GFF2839 Length = 283 Score = 169 bits (429), Expect = 6e-47 Identities = 125/314 (39%), Positives = 164/314 (52%), Gaps = 45/314 (14%) Query: 2 IIERCRELALRAPARVVFPDALDQRVLKAAQYLHQQGL--ATPILVANPFELRQFALSHG 59 ++E+ A ARVVFP+ D RV A L ++GL A P+ + + + G Sbjct: 3 VLEKAYAQARNRKARVVFPEMDDPRVAAAVDQLTREGLVEAVPLAPVSAAHVEVLVAARG 62 Query: 60 VAMDGLQVIDPHGNLAMREEFAHRWLARAGEKTPPDALEKLTDPLMFAAAMVSAGKADVC 119 M+E A R L++ PL AAAMV+AG+AD Sbjct: 63 ----------------MKEGIAKRMLSK---------------PLYRAAAMVAAGEADAM 91 Query: 120 IAGNLSSTANVLRAGLRIIGLQPGCKTLSSIFLMLPQYSGPALGFADCSVVPQPTAAQLA 179 +AG T V+ A IGL G T SS FLM+ G L FADC+V P AAQLA Sbjct: 92 VAGADVPTRRVIEAASIGIGLDAGVSTASSFFLMIFP-DGRELVFADCAVNVAPDAAQLA 150 Query: 180 DIALASAETWRAITGEEPRVAMLSFSSNGSARHPCVANVQQATEIVRERAPKLVVDGELQ 239 DIA AS + A+ G RVAMLSFS++ S VA V+ A E P +Q Sbjct: 151 DIARASTRSAEALLGAA-RVAMLSFSTDTSGDGDSVALVRAAAEASGFAGP-------VQ 202 Query: 240 FDAAFVPEVAAQKAPASPLQGKANVMVFPSLEAGNIGYKIAQRLGGYRAVGPLIQGLAAP 299 DAA P +A +K A KANV++FP+L+AGNIGYK+ Q LGG +A+GP +QG A P Sbjct: 203 ADAALNPAIAEKKGIAPV---KANVLIFPTLDAGNIGYKLCQELGGAQALGPFLQGFAKP 259 Query: 300 MHDLSRGCSVQEII 313 + DLSRG SV++I+ Sbjct: 260 VCDLSRGASVEDIV 273 Lambda K H 0.320 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 283 Length adjustment: 27 Effective length of query: 311 Effective length of database: 256 Effective search space: 79616 Effective search space used: 79616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory