Align glucose 1-dehydrogenase (PQQ, quinone) (EC 1.1.5.2) (characterized)
to candidate GFF1567 PGA1_c15880 soluble aldose sugar dehydrogenase YliI
Query= BRENDA::I7A144 (352 letters) >FitnessBrowser__Phaeo:GFF1567 Length = 367 Score = 197 bits (502), Expect = 3e-55 Identities = 133/354 (37%), Positives = 184/354 (51%), Gaps = 50/354 (14%) Query: 15 LARGQG-LRVEEVVGGLEVPWALAFLPDGGMLIAERPGRIRLFREGRLSTYAELP-VYHR 72 L QG LR+E++V GL++PW FLPDG +LI+ER G + L R+GRL+ P V + Sbjct: 26 LTSSQGALRIEKMVQGLDIPWGFDFLPDGSVLISERAGNLLLLRDGRLTRIKGTPKVSDQ 85 Query: 73 GESGLLGLALHPRFPEAPYVY----------AYRTVAEGGLRNQVVRLRHLGERGVLDRV 122 G+ GLL + + F + +Y + VA G L + +L+ L R Sbjct: 86 GQGGLLDVMVPRTFAKTRRIYLTYAKRVGRGSATAVATGQLARRNTQLQGL-------RD 138 Query: 123 VLDGIPARPHGLHSGGRIAFGPDGMLYVTTGEVYERELAQDLASLGGKILRLTPEGEPAP 182 + PA G H G R+A GPDG +YVT G+ +R+ AQ LAS G ILRLTPEG Sbjct: 139 IFVAAPAVSSGRHFGSRLAEGPDGHIYVTLGDRGDRQSAQVLASHQGSILRLTPEGSAPR 198 Query: 183 GNPFLGRRGARPEVYSLGHRNPQGLAWHPKTGELFSSEHGPSGEQGYGHDEVNLIVPGGN 242 NP RRGA+PE++S GHRNPQGL + G L+S EHG G DEVN I G N Sbjct: 199 SNPLTKRRGAQPEIWSYGHRNPQGLTF-AADGSLWSVEHG-----ARGGDEVNRIEKGAN 252 Query: 243 YGWPRV----------VGRGND-PRYRDPLYFWPQGFPPGNLAFF--------RGDLYVA 283 YGWP + +G G + P + P Y+W P NL + RGD++V Sbjct: 253 YGWPIISYGRHYSGLTIGEGTEKPGLKQPQYYWDPSIAPSNLLVYSGKMWPDWRGDIFVG 312 Query: 284 GLRGQALLRLVLEGERGRWRVLRVETALSGFGRLREVQVGPDGALYVTTSNRDG 337 L+ + RL + +V +T GR+R+++ PDG+++ S DG Sbjct: 313 SLKFDYIARLSGSPLKEVEQVKGEQT-----GRIRDLREAPDGSIWF-ASETDG 360 Score = 23.5 bits (49), Expect = 0.009 Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 323 GPDGALYVTTSNRDGR 338 GPDG +YVT +R R Sbjct: 159 GPDGHIYVTLGDRGDR 174 Lambda K H 0.322 0.146 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 352 Length of database: 367 Length adjustment: 29 Effective length of query: 323 Effective length of database: 338 Effective search space: 109174 Effective search space used: 109174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory