Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate GFF774 PGA1_c07880 alpha-glucoside transport system permease protein AglG
Query= TCDB::Q72KX4 (268 letters) >FitnessBrowser__Phaeo:GFF774 Length = 382 Score = 135 bits (339), Expect = 2e-36 Identities = 75/208 (36%), Positives = 112/208 (53%), Gaps = 3/208 (1%) Query: 63 FQNSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSILIPLFQFM 122 F N++ + + AT++ LV + Y LA F G LL A I+ + +P Q LIPL +F Sbjct: 175 FFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLVAAIVGLLVVPLQLALIPLLKFH 234 Query: 123 KSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFFGIFRHVILP 182 IG+ G+ + H +G+P+ + RNY IP +++E AR+DGA F IF +ILP Sbjct: 235 NEIGIGKGYIGVWMAHTGFGLPLAIYLLRNYMVGIPRDIIENARVDGATDFLIFVRIILP 294 Query: 183 LSVPAFVVVAIWQFTQIWNEFLFAVTL---TRPESQPITVALAQLAGGEAVKWNLPMAGA 239 LS PA AI+QF WN+ L A+ E+ +T + +L G W + A Sbjct: 295 LSFPALASFAIFQFLWTWNDLLVAMVFLIDATGETTVMTKQIVELLGTRGGNWEILATSA 354 Query: 240 ILAALPTLLVYILLGRYFLRGLLAGSVK 267 ++ L V+ + +Y +RGLLAGSVK Sbjct: 355 FVSIAVPLAVFFAMQKYLVRGLLAGSVK 382 Lambda K H 0.330 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 382 Length adjustment: 28 Effective length of query: 240 Effective length of database: 354 Effective search space: 84960 Effective search space used: 84960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory