Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate GFF262 PGA1_c02740 sn-glycerol-3-phosphate import ATP-binding protein UgbC
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Phaeo:GFF262 Length = 348 Score = 328 bits (842), Expect = 1e-94 Identities = 188/376 (50%), Positives = 247/376 (65%), Gaps = 30/376 (7%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M + L+++ K YPN +V + + I D EF+V VGPSGCGKST LRMIAGLEDITEG Sbjct: 1 MAQVTLNSVRKVYPNGVE-AVTSSSFKIEDGEFVVLVGPSGCGKSTLLRMIAGLEDITEG 59 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 L I D+++N+ P DRDIAMVFQNYALYPHM+V +N+A+GLK RK + +I ++V EAA Sbjct: 60 TLEIGDRVVNNVDPADRDIAMVFQNYALYPHMTVRKNIAYGLKNRKTPEAEIKQKVAEAA 119 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 ++L L E+L+RKP+ LSGGQRQRVAMGRAIVRD +FL DEPLSNLDAKLR MR EI Sbjct: 120 KMLNLEEYLDRKPSQLSGGQRQRVAMGRAIVRDPALFLFDEPLSNLDAKLRNQMRIEIKA 179 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 + RR+G T+IYVTHDQ EAMT+ADRI++++ GRIEQIGTP E+Y+ PA+ Sbjct: 180 LQRRLGVTSIYVTHDQVEAMTMADRIIVLNG----------GRIEQIGTPSEIYHNPASV 229 Query: 241 FVAGFIGSPAMNFFEVTVEKERLVNQDGLSL-ALPQGQEKILEEKGYLGKKVTLGIRPED 299 FVA F+G+P MN + T+ ++ DG+S+ AL + V LGIRPED Sbjct: 230 FVASFMGAPPMNLLDATIANGQVTLPDGVSMGALDTSAQ----------GAVKLGIRPED 279 Query: 300 ISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKVQLT 359 + Q+V E + D+ + E LG+ +L+ K G FT V PG Q++ Sbjct: 280 V---QLVAE----GGLAIDVELIEELGAHRLLHGKLGGQPFTIHVLKDIPVDPGTH-QIS 331 Query: 360 FNIAKGHFFDLETEKR 375 + A FD E+ +R Sbjct: 332 VDPAAICLFDAESGQR 347 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 348 Length adjustment: 29 Effective length of query: 348 Effective length of database: 319 Effective search space: 111012 Effective search space used: 111012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory