Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate GFF2690 PGA1_c27320 putative sugar ABC transporter, ATP-binding protein
Query= TCDB::Q00752 (377 letters) >FitnessBrowser__Phaeo:GFF2690 Length = 349 Score = 311 bits (797), Expect = 2e-89 Identities = 173/376 (46%), Positives = 238/376 (63%), Gaps = 29/376 (7%) Query: 1 MVELNLNHIYKKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKG 60 M ++ L +I K++ S V++FDL I +KEF+V +GPSGCGK+TT+RM+AGLE ++G Sbjct: 1 MAQIELRNISKRW--GSFVGVDNFDLTIADKEFLVLLGPSGCGKTTTMRMIAGLESASEG 58 Query: 61 ELKIDGEVVNDKAPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAA 120 ++ +DG VN+ PKDRD+AMVFQ+YALYP+M+VY+N+ F LK+R + D++V+ A+ Sbjct: 59 DILVDGNRVNELEPKDRDVAMVFQSYALYPNMNVYENIRFPLKVRGVDAKTHDEKVRRAS 118 Query: 121 QILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAK 180 ++ L EFL RKPA+LSGGQRQRVA+ RAIVR+ VFLMDEPLSNLDAKLRVS RA+I Sbjct: 119 AMVELDEFLHRKPAELSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKN 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPANK 240 + + TTIYVTHDQ EAMTLADR+V+M+ G V+QVG+P E+Y+RPAN Sbjct: 179 LSHELAVTTIYVTHDQIEAMTLADRVVVMNK----------GVVQQVGSPTEIYDRPANA 228 Query: 241 FVAGFIGSPAMNFFDVTIKDGHLVSKDGLTIAVTEGQLKMLESKGFKNKNLIFGIRPEDI 300 FVA FIGSPAMN + + G ++ IA GQ + + G R ED Sbjct: 229 FVASFIGSPAMNLMEGGLSGGRFTAQH-TDIAGLSGQ----------DGPVTLGFRAEDA 277 Query: 301 SSSLLVQETYPDATVDAEVVVSELLGSETMLYLKLGQTEFAARVDARDFHEPGEKVSLTF 360 S ++A + ELLG TM+ +++G + + D E + VS+ Sbjct: 278 S------VVDSGGQINAPIYTMELLGDATMVTVRIGGVLVSVKADKTFRAEIDDMVSIHV 331 Query: 361 NVAKGHFFDAETEAAI 376 H FD +T A + Sbjct: 332 PTDHCHLFDTQTGARL 347 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 349 Length adjustment: 29 Effective length of query: 348 Effective length of database: 320 Effective search space: 111360 Effective search space used: 111360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory