Align Trehalose/maltose transport system permease protein MalF (characterized)
to candidate GFF1304 PGA1_c13200 ABC transporter permease protein
Query= SwissProt::O51924 (295 letters) >FitnessBrowser__Phaeo:GFF1304 Length = 288 Score = 129 bits (323), Expect = 1e-34 Identities = 83/276 (30%), Positives = 148/276 (53%), Gaps = 11/276 (3%) Query: 19 LMILPLLTVVLVFIILPVMGTFWISLHRDVTFIP----EKPFVGLRNYLRVLSAREFWYS 74 +M+ P + ++L ++++P+ T + S + ++P + +VG NY R LS+ FW S Sbjct: 12 IMMAPAVILLLGWMLVPLTMTLYFSFKK---YLPLRGGDLGWVGFDNYARFLSSSAFWPS 68 Query: 75 TFVTVSFSFVSVSLETILGLSFALILNERLKGRGVLRAIVLIPWAVPTIISARTWELMY- 133 T+ +++ ILG+ AL+LN+ + G+G++R +V+ P+ V +SA W+ M+ Sbjct: 69 VQATLVIVGGVLAITVILGVFLALLLNQPMWGQGIVRILVIAPFFVMPTVSALVWKNMFM 128 Query: 134 NYSYGLFNWILSILGVSPVNWLGTPISAFFAIVIADVWKTTPFMTLLLLAGLQAIPQDLY 193 + GLF + G PV+WL ++ +I++ W+ PF TL+LL +Q++ + Sbjct: 129 DPVNGLFAHLWKAFGAEPVSWLSE--ASLQSIILIVSWQWLPFATLILLTAIQSLDSEQL 186 Query: 194 EAALIDGASMFERFKSITLPLLKPVLIVALILRTIDALRVFDIIYVLTGGGPGGATTSIS 253 EAA +DGA RF ITLP L + V ++++TI L +F I+V T G G T + Sbjct: 187 EAAEMDGAPPVARFGYITLPHLSRAITVVVLIQTIFLLSIFAEIFVTTQGSFGTKTLTY- 245 Query: 254 LLAFNYYNLGDYGIGSAISILTFVLVLSFTIVYLKV 289 L+ + G+GSA + +L I +++ Sbjct: 246 LIYQRVLESQNVGLGSAGGVYAIILANIVAIFLMRI 281 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 288 Length adjustment: 26 Effective length of query: 269 Effective length of database: 262 Effective search space: 70478 Effective search space used: 70478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory