Align MalF, component of Maltose/trehalose porter (characterized)
to candidate GFF508 PGA1_c05200 putative ABC transporter, inner membrane component
Query= TCDB::O51924 (300 letters) >FitnessBrowser__Phaeo:GFF508 Length = 287 Score = 120 bits (300), Expect = 5e-32 Identities = 85/283 (30%), Positives = 149/283 (52%), Gaps = 12/283 (4%) Query: 18 EAKLGYLMILPLLTVVLVFIILPVMGTFWISLHRDVTFIPEKPF-VGLRNYLRVLSAREF 76 E + + +LP+L +V ++P+M S+ TF F GL + ++L + F Sbjct: 4 ENQKAWFFVLPVLLLVAFNALIPMMTVVNYSVQE--TFGDNVFFWQGLDWFQQILRSDRF 61 Query: 77 WYSTFVTVSFSFVSVSLETILGLSFALILNERLKGRGVLRAIVLIPWAVPTIISARTWEL 136 + F+F+ + +E LG++ AL + + V ++ +P +P + W + Sbjct: 62 HAALGRQFMFTFLILIIEIPLGIAIALSMPRKGFWVPVCLVLMALPMLIPWNVVGAMWNI 121 Query: 137 MYNYSYGLFNWILS-ILGVSPVNWLGTPISAFFAIVIADVWKTTPLMTLLLLAGLQAIPQ 195 GL + L+ LG++ + PI+A+ I+ DVW T L+ LL AGL +IP Sbjct: 122 FTLPDIGLLGYFLNHTLGIN-YDMTQDPIAAWVTIITMDVWHWTSLVVLLSYAGLVSIPD 180 Query: 196 DLYEAALIDGASMFERFKSITLPLLKPVLIVALILRTIDALRVFDIIYVLTGGGPGGATT 255 Y+AA IDGAS + F+ I LP +K VL +A++LR +D+ ++ +VLTGGGPG +TT Sbjct: 181 AYYQAAKIDGASNWAVFRFIQLPKMKTVLTIAILLRFMDSFNIYTEPFVLTGGGPGNSTT 240 Query: 256 SISL----LAFNYYNLGDYGIGSAISILTFVLVLSFTIVYLKV 294 +S+ +A ++LG +A+S++ F + L + ++ V Sbjct: 241 LLSIDLVKIALGQFDLGP---AAAMSLIYFAITLLVSWLFYTV 280 Lambda K H 0.329 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 287 Length adjustment: 26 Effective length of query: 274 Effective length of database: 261 Effective search space: 71514 Effective search space used: 71514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory