Align Trehalose transport system permease protein SugB (characterized)
to candidate GFF507 PGA1_c05190 ABC transporter, inner membrane component
Query= SwissProt::P9WG01 (274 letters) >FitnessBrowser__Phaeo:GFF507 Length = 265 Score = 134 bits (337), Expect = 2e-36 Identities = 84/263 (31%), Positives = 130/263 (49%), Gaps = 4/263 (1%) Query: 11 VLDTLVVGYALLPVLWIFSLSLKPTSTVKDG-KLIPSTVTFDNYRGIFRGDLFSSALINS 69 ++ + + + +LP+ W+ ++S K T+ + G L P T T +NY IF + INS Sbjct: 6 IVPIVYILFLMLPIYWLVAMSFKTTNEILSGFSLFPQTFTLENYATIFTDPSWYWGYINS 65 Query: 70 IGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTPLFNIERAIG 129 I I TVI+V + AAYA +R F G + L L M P+ P F + A+G Sbjct: 66 IIYVSINTVISVAVALPAAYAFSRYRFLGDKQLFFWLLTNRMAPAAVFALPFFQLYSAVG 125 Query: 130 LFDTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGATPGQAFRKVIVPLAAP 189 LFDT + L + F +PLA++ L F IP +L++ A +DG + + F + +P Sbjct: 126 LFDTHLAVALAHCLFNIPLAVWILEGFMGGIPKELDETAYVDGYSFPRFFATIFIPSIKA 185 Query: 190 GLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGSIAAGAIVIT 249 G+ AA F+F+W +LLLA +LTA A P+A +S G +AA + Sbjct: 186 GVGVAAFFCFMFSWVELLLAKTLTAVAA---KPIAATMTKTASSAGYELGLLAAAGTLTI 242 Query: 250 IPIIVFVLIFQRRIVAGLTSGAV 272 IP + + + I G G V Sbjct: 243 IPGAIVIYFVRNYIAKGFAMGRV 265 Lambda K H 0.327 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 265 Length adjustment: 25 Effective length of query: 249 Effective length of database: 240 Effective search space: 59760 Effective search space used: 59760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory