Align TreU, component of Trehalose porter (characterized)
to candidate GFF1646 PGA1_c16690 binding protein-dependent transport system, inner membrane component
Query= TCDB::Q97ZC1 (267 letters) >FitnessBrowser__Phaeo:GFF1646 Length = 283 Score = 124 bits (311), Expect = 2e-33 Identities = 81/257 (31%), Positives = 129/257 (50%), Gaps = 5/257 (1%) Query: 15 YFLFPLYILVLLAFNSPKYTVLAKFPSLLPVSLTLNNLLTALQGTAFIDPFIKSLETATL 74 + LFPLY L+ +A +P + ++ +LP ++T N T L T F+ F SL + Sbjct: 28 FALFPLYWLMKIAI-TPDALIFSEGTRMLPSAVTFENFATVLFETEFLAYFRNSLTVSLG 86 Query: 75 VGIITIALAIPAGYGLSRLPRAIAYSIIILLLVTNMMPAIVIGIPIAVDFLKLHLFESVV 134 T +A AGY SR A II ++L+T M P ++I PI L L S+ Sbjct: 87 TAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLITQMFPLLMIIAPIYKIVADLGLLNSLT 146 Query: 135 GLALAQTLITLPLATFILQGTFSSIPIDLEHQARVDGANLFNRLFSVLLPLAAPGIAAAF 194 L + T +P ATF++Q F IP DLE A +DG + F L +V+ PL PG+ A Sbjct: 147 SLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAMMDGCSRFQALRTVVFPLTLPGLGATL 206 Query: 195 LISWMFSWDEFTYAILLIPYHS--TLPVTIYQDVTRGNLLAG--IAFSLIFTLPVIILTF 250 + +W E +A++LI + T PV + V++ ++ G +A ++ +P + Sbjct: 207 GFVFTAAWSELLFALMLISKNDAMTFPVGLLTFVSKFSVDWGQMMAAGVLALVPSCLFFI 266 Query: 251 ALQKYLRGEYLAGGIKG 267 +Q+YL +G +KG Sbjct: 267 FIQRYLVQGLTSGAVKG 283 Lambda K H 0.330 0.146 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 283 Length adjustment: 25 Effective length of query: 242 Effective length of database: 258 Effective search space: 62436 Effective search space used: 62436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory