Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate GFF249 PGA1_c02610 putative high-affinity branched-chain amino acid transport ATP-binding protein LivG
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__Phaeo:GFF249 Length = 255 Score = 198 bits (504), Expect = 8e-56 Identities = 104/251 (41%), Positives = 155/251 (61%), Gaps = 1/251 (0%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +L++ + +FGG+ A++D+ +++ G+VY ++GPNGAGK+T FN+I+ Y P +G Sbjct: 3 LLEIEHATLKFGGVVAVNDLSFSVEEGEVYAIVGPNGAGKSTVFNLISRFYQPHSGRLSF 62 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 G+ + VA GIARTFQNI LF T L+N++VGRH S L +F T + Sbjct: 63 DGRDLLQSKADAVADLGIARTFQNIELFDHATVLQNLLVGRHRHRRSTLMEELFFTPRVR 122 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 EE +E++D++ + + D L YG ++ +E+ RALA+ P+L+ LDEPA+G+ Sbjct: 123 REERRHRAAVEEVIDFLDLQAYRDKMIAGLPYGVRKVVELGRALASGPRLLLLDEPASGL 182 Query: 189 NATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKN 247 + E +R ID IR T+L++EHD+ LV + DRV L G ++AEG PAEVQ N Sbjct: 183 SVEETRDMRWWIDDIRKQMGITVLMVEHDMGLVSSVSDRVLALADGAKLAEGTPAEVQAN 242 Query: 248 EKVIEAYLGTG 258 VIEAYLG G Sbjct: 243 PAVIEAYLGAG 253 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 255 Length adjustment: 24 Effective length of query: 236 Effective length of database: 231 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory