Align ABC transporter permease (characterized, see rationale)
to candidate GFF247 PGA1_c02590 putative high-affinity branched-chain amino acid transport system permease protein LivH
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__Phaeo:GFF247 Length = 291 Score = 146 bits (368), Expect = 6e-40 Identities = 90/299 (30%), Positives = 152/299 (50%), Gaps = 17/299 (5%) Query: 5 LQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPGA 64 +Q +++GL G +Y LIALG+ ++Y + +NFA G+ +M+GA + +G+ Sbjct: 4 VQLLVSGLANGCVYGLIALGFVLIYKATEAVNFAQGDFMMLGAFVT---LGLTNAEYLHL 60 Query: 65 PGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMIIWK 124 P W LA ++ + A L ++++ V R L + A +I I + +++ A IW Sbjct: 61 PFW----LAAPLSIAIMAGLGYLLDLVILRHLFGQNQTAVVILTIALGFVIRFFAGAIWG 116 Query: 125 PNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRATAENP 184 + + L ++ G + + I+ VT + SL T LG AM+A ++N Sbjct: 117 HEPQTLESPLALGDVQLAGVVLGLADLAIIIVTVLLTWSLYQFFQRTKLGLAMQAASQNQ 176 Query: 185 RVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVFGGI 244 A MG+ V + + AA+AGI++AS G G L G+KAF AAV GG Sbjct: 177 MAAYFMGIPVKRVQGLIWGLSGATAAVAGILFASK-GAIDPNAGLL-GIKAFAAAVIGGF 234 Query: 245 GNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGLLGE 303 G+L GA+ GG+++G+IE + Y L + Y+ I +++L+ +L RP GL + Sbjct: 235 GSLPGALAGGLIVGVIEPFAARY--------LAAGYSQIAPYVLLLAVLVFRPHGLFSQ 285 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 291 Length adjustment: 27 Effective length of query: 282 Effective length of database: 264 Effective search space: 74448 Effective search space used: 74448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory