GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Phaeobacter inhibens BS107

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate GFF3780 PGA1_262p01840 ATP-dependent AMP binding enzyme

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|FitnessBrowser__Phaeo:GFF3780 PGA1_262p01840 ATP-dependent AMP
           binding enzyme
          Length = 543

 Score =  188 bits (478), Expect = 4e-52
 Identities = 154/527 (29%), Positives = 239/527 (45%), Gaps = 45/527 (8%)

Query: 56  RYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVNINPAY 115
           R T+ ++ T    +A+ L+ +G+  GD V +   N  E   +Q A    G V+  +N   
Sbjct: 43  RRTWGEVATRIRGVAAGLVSLGIGRGDTVSVLCPNIPELFELQFALPLTGAVINTLNTRL 102

Query: 116 RTAEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTVVW 175
               + Y L+    K ++            + REL P         +  A + +  +V+ 
Sbjct: 103 EPETIAYILDHADTKAVI------------VDRELIPLLS------MAFAAMGRSVSVIE 144

Query: 176 IDDEAGQGADEPGLLRFTELIARGNAADPRLAQVAAGLQATDPINIQFTSGTTGFPKGAT 235
           IDD             + EL+  G    P    +       D I + +TSGT+G PKG  
Sbjct: 145 IDDRNVAAPHTLVGKPYEELLTDGAGGAP----LDLPQDEWDAIALNYTSGTSGRPKGVV 200

Query: 236 LTHRNILNNGFFIGECMKLTPADRLCIPVPLYHCFGMVLGNLACFTHGATIVYPNDGFDP 295
             HR             +          VP++HC G     +     G T+V+      P
Sbjct: 201 YHHRGAYLMALGTAAAWQTPHYPIYLSVVPMFHCNGWGHSWVMAML-GGTMVFTRTP-SP 258

Query: 296 LTVLQTVQDERCTGLHGVPTMF--IAELDHPRFAEFNLSTLRTGIMAGSPCPTEVMKRVV 353
             +L  ++    T     P +   +AE +    +          + AG+P P  V+++  
Sbjct: 259 DLILDAIRSHGVTHFGAAPIVLQMLAEAEAETGSTTPFDPAIKVLTAGAPPPPSVLQKT- 317

Query: 354 EQMNLREITIAYGMTET----SPVSCQSSTDTPLSKRVSTV----GQVQPHLE-VKIVDP 404
           + M L ++   YG+TET    S    Q S    +    + +    G   P +E V ++D 
Sbjct: 318 KAMGL-DVMQVYGLTETYGHISKCLWQDSWADKIEAEQAQLQAQQGIAMPMVEAVSVIDT 376

Query: 405 DTGAVVPIGQ----RGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDLATMDAEGYV 460
           DTG  +P+ +    +GE   +G +VM GY+ D   T +A  E GW  +GD A + A+GY+
Sbjct: 377 DTG--IPVARDGQTQGEIAVRGNTVMKGYYKDADATDKAF-ENGWFWSGDGAVVHADGYM 433

Query: 461 NIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQ 520
            I  R+KD++I GGENI   E+E  LYRHP VQ   VV  PD K+GE  CA+I  + G+ 
Sbjct: 434 QIRDRLKDVIISGGENISSVEVEAVLYRHPAVQAAAVVAKPDPKWGEVPCAFIELRTGSD 493

Query: 521 PTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIRDEMK 567
            T ++I AFC+  +A +K P+ + F TS P T TGKIQKF++RD  K
Sbjct: 494 LTSEEIIAFCRTHLAGFKAPKTVVF-TSLPKTSTGKIQKFQLRDAAK 539


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 703
Number of extensions: 48
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 543
Length adjustment: 36
Effective length of query: 542
Effective length of database: 507
Effective search space:   274794
Effective search space used:   274794
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory