Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate GFF43 PGA1_c00430 fumarylacetoacetase Fah
Query= BRENDA::Q8RW90 (421 letters) >FitnessBrowser__Phaeo:GFF43 Length = 418 Score = 375 bits (963), Expect = e-108 Identities = 197/420 (46%), Positives = 263/420 (62%), Gaps = 14/420 (3%) Query: 1 MALLKSFID-VGSDSH-FPIQNLPYGVFKPESNSTPRPAVAIGDLVLDLSAISEAGLFDG 58 M L+KS++ S +H FP+ NLPYGVF +S+ PR VAIGD++LD+ A E GL Sbjct: 1 MPLMKSWVSSANSTAHPFPLNNLPYGVFSVDSDD-PRCGVAIGDMILDMQAAEETGLIQ- 58 Query: 59 LILKDADCFLQPNLNKFLAMGRPAWKEARSTLQRILSSNEPILRDNDVLRRKSFHQMSKV 118 L D F P N + G W R L +LS + L + S Sbjct: 59 --LGDVPLFDVPYWNDLMEEGPAVWAALRDRLTALLSEGAAEQEKVEPLLVAA----SAA 112 Query: 119 EMIVPMVIGDYTDFFASMHHAKNCGLMFRGPENAINPNWFRLPIAYHGRASSIVISGTDI 178 E+ +P + +YTDF+A +HA N G MFRGPENA+ PNW +PI Y+GRASS+V SGTD+ Sbjct: 113 ELHMPFAVSEYTDFYAGKNHAFNVGTMFRGPENALPPNWLHIPIGYNGRASSVVASGTDV 172 Query: 179 IRPRGQGHPQGNSEPYFGPSKKLDFELEMAAVVGPGNELGKPIDVNNAADHIFGLLLMND 238 RP GQ + +P + P + D ELEM A+VG +E PI V A DHIFG +L+ND Sbjct: 173 RRPWGQLKGPNDDKPRWAPCARFDIELEMGAIVGTPSE--GPITVQEADDHIFGYVLLND 230 Query: 239 WSARDIQAWEYVPLGPFLGKSFGTTISPWIVTLDALEPFGCQAPKQDPPPLPYLAEKESV 298 WSARDIQAWEY PLGPF K+ TISPWIVT ALEPF C P+++ L +L + + Sbjct: 231 WSARDIQAWEYQPLGPFQAKATANTISPWIVTKAALEPFRCDTPEREVELLDHLKDCGPM 290 Query: 299 NYDISLEVQLKPSGRDDSCVITKSNFQNLYWTITQQLAHHTVNGCNLRPGDLLGTGTISG 358 YDI LEV + P G+ ++ I ++N++ +Y++ QQLAHH +GC + GDLLG+GTISG Sbjct: 291 LYDIDLEVTMAPEGK-EATTIARTNYKEMYYSAAQQLAHHATSGCPMNAGDLLGSGTISG 349 Query: 359 PEPDSYGCLLELTWNGQKPLSLN-GTTQTFLEDGDQVTFSGVCKGDGYNVGFGTCTGKIV 417 DS G LLEL+W G++PL+L+ G ++F+ DGD +T G KGDGY +GFG CTG ++ Sbjct: 350 STKDSRGSLLELSWGGKEPLTLDTGEERSFIADGDTLTLKGAAKGDGYTIGFGDCTGTVL 409 Lambda K H 0.319 0.139 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 418 Length adjustment: 32 Effective length of query: 389 Effective length of database: 386 Effective search space: 150154 Effective search space used: 150154 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF43 PGA1_c00430 (fumarylacetoacetase Fah)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.10116.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-153 496.5 0.0 3.6e-153 496.3 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF43 PGA1_c00430 fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF43 PGA1_c00430 fumarylacetoacetase Fah # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 496.3 0.0 3.6e-153 3.6e-153 1 420 [] 6 412 .. 6 412 .. 0.96 Alignments for each domain: == domain 1 score: 496.3 bits; conditional E-value: 3.6e-153 TIGR01266 1 sfvavak..nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfkestlnaflalgr 76 s+v++a+ +fpl+nlPyGvfs + ++r+gvaiGd ild++++ ++gl + f+ n ++ g lcl|FitnessBrowser__Phaeo:GFF43 6 SWVSSANstAHPFPLNNLPYGVFSV-DSDDPRCGVAIGDMILDMQAAEETGLIQL----GDVPLFDVPYWNDLMEEGP 78 89*999955569************5.55689******************888766....567899************* PP TIGR01266 77 parkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirhatnvGilfrgkdnallPnyk 154 +++ ++r+rl llse a+ +++ + +l+a++ a+ h+P + +ytdfy++ +ha nvG +frg++nal Pn+ lcl|FitnessBrowser__Phaeo:GFF43 79 AVWAALRDRLTALLSEGAAE----QEKVEPLLVAASAAELHMPFAVSEYTDFYAGKNHAFNVGTMFRGPENALPPNWL 152 ***************66665....66777899********************************************** PP TIGR01266 155 hlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelelaffvgtenelGeavpiekaeehifGvvll 232 h+P+gy Grassvv sGt++rrP Gq+k +n ++P ++pc+++d+ele++ vgt+ e ++ ++ a++hifG vll lcl|FitnessBrowser__Phaeo:GFF43 153 HIPIGYNGRASSVVASGTDVRRPWGQLKGPNDDKPRWAPCARFDIELEMGAIVGTPSE--GPITVQEADDHIFGYVLL 228 *******************************************************997..69**************** PP TIGR01266 233 ndwsardiqaweyvPlGPflaksfattvsPwvvsiealePfrvaqlePeqdpkplpylredradtafdielevslkte 310 ndwsardiqawey+PlGPf ak+ a t+sPw+v+ alePfr Pe++ ++l +l++ ++ +di+lev++ +e lcl|FitnessBrowser__Phaeo:GFF43 229 NDWSARDIQAWEYQPLGPFQAKATANTISPWIVTKAALEPFRCD--TPEREVELLDHLKDC-GPMLYDIDLEVTMAPE 303 *******************************************9..9***********998.9*************** PP TIGR01266 311 GlaeaavisrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkkevkladgetrkfl 388 G +ea++i+r+n k++y++ +qqlahh+ +Gc ++aGdllgsGtisG+ +++ Gsllels++Gk+++ l ge+r f+ lcl|FitnessBrowser__Phaeo:GFF43 304 G-KEATTIARTNYKEMYYSAAQQLAHHATSGCPMNAGDLLGSGTISGSTKDSRGSLLELSWGGKEPLTLDTGEERSFI 380 *.99************************************************************************** PP TIGR01266 389 edGdevilrgvckkeGvrvGfGecaGkvlpal 420 dGd++ l+g +k +G+++GfG+c+G+vl+al lcl|FitnessBrowser__Phaeo:GFF43 381 ADGDTLTLKGAAKGDGYTIGFGDCTGTVLAAL 412 *****************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (418 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.99 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory