Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate GFF348 PGA1_c03590 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Query= curated2:P37942 (424 letters) >FitnessBrowser__Phaeo:GFF348 Length = 516 Score = 245 bits (626), Expect = 2e-69 Identities = 152/420 (36%), Positives = 218/420 (51%), Gaps = 23/420 (5%) Query: 2 AIEQMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELV 61 A + +P LGESV+E T+S W GD V + + + E+ TDKV+ EVP+ G +TE+ Sbjct: 105 AATDVMVPTLGESVSEATVSTWFKKVGDSVAQDEMLCELETDKVSVEVPAPTAGILTEIT 164 Query: 62 GEEGQTLQVGEMICKI---ETEGANPAEQKQEQPAASEAAENPVAKSAGAADQPNKKRYS 118 EEG T+ + I E P K E ++ P + A D N + Sbjct: 165 AEEGSTVDATAKLGVISGGEAGAVTPTPSKGETAGGAQYTTPPAGQGGPAKDIAN----A 220 Query: 119 PAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSASK 178 P+ + E G+ DQV G+G GRI + D+ R + AAPA S S Sbjct: 221 PSAEKAMAEAGLSADQVQGSGRDGRIMKDDVARAVAAAA-----------AAPAA-STSA 268 Query: 179 PEPKEETSYPASA---AGDKEIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYR 235 P P +A A ++ + +T +R+ IA +K S+ T EVD+T ++A R Sbjct: 269 PAAAAPVRAPVAADDAAREERVKMTRLRQTIAKRLKDSQNTAAMLTTYNEVDMTEVMALR 328 Query: 236 NSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATED 295 N KD F K G L F +FF KA AL E P++N+ G I+ K +++ IA T Sbjct: 329 NEYKDLFLKKHGVKLGFMSFFTKACVHALNEVPEVNAEIDGTDIVYKNFVHMGIAAGTPT 388 Query: 296 SLFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGSVQSMGI 355 L VPVI++AD + I K I + RDGKL+ +MQGGTFT++N G +GS+ S I Sbjct: 389 GLVVPVIRDADAMSFADIEKAIAEKGARARDGKLSMAEMQGGTFTISNGGVYGSLMSSPI 448 Query: 356 INYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILE 415 +N PQ+ IL + I RP+ + NG + +R M+ L LS DHR++DG FL RVK+ LE Sbjct: 449 LNPPQSGILGMHKIQDRPMAI-NGKVEIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALE 507 Score = 71.2 bits (173), Expect = 7e-17 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 2/105 (1%) Query: 5 QMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELVGEE 64 ++ +P LGESVTE T++ W PGD V + + E+ TDKV EVP+ GT+ E+V E Sbjct: 4 EVRVPTLGESVTEATVATWFKKPGDAVAADEMLCELETDKVTVEVPAPAAGTLGEIVAAE 63 Query: 65 GQTLQVGEMICKIETEGANPAEQKQEQPAASEAAENPVAKSAGAA 109 G+T+ V ++ I G++ A +A A ++ AGAA Sbjct: 64 GETVGVDALLATIAEGGSDTA--AAPATSAPAATKDAAEGDAGAA 106 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 26 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 424 Length of database: 516 Length adjustment: 33 Effective length of query: 391 Effective length of database: 483 Effective search space: 188853 Effective search space used: 188853 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory