Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate GFF3205 PGA1_c32580 high-affinity branched-chain amino acid transport permease protein
Query= TCDB::Q8DQH9 (318 letters) >FitnessBrowser__Phaeo:GFF3205 Length = 358 Score = 139 bits (350), Expect = 1e-37 Identities = 99/315 (31%), Positives = 162/315 (51%), Gaps = 34/315 (10%) Query: 22 ISVLVSVGVLNLFYVQ-ILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAII 80 ++ LV V+N ++ IL I I A+GLN++VG+ GQ SLG GFMA+GAYA + Sbjct: 35 LAFLVVPFVVNDYWANAILLPFLIYSIAAIGLNILVGYCGQVSLGTGGFMAVGAYACYKL 94 Query: 81 GSKSPTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIIN--- 137 + P F +L G ++ V + G+P+LR+KG YLAVATL ++ +++ N Sbjct: 95 MTAFPEMSMFIHVLLAGG-ITALVCIGFGLPSLRIKGFYLAVATL-AAQFFLVWLFNRVP 152 Query: 138 -------GGSLTNGAAGILGI----PNFTTWQMVYF---FVVITTIATLNFLRSPIGRST 183 G ++ + GI PN W F F+ + N R +GRS Sbjct: 153 WFYNYSASGQISAPERDVFGIIITGPNAPAWATYMFSLIFLAFCALVARNLTRGTVGRSW 212 Query: 184 LSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSL-QAGFIGSV-VPKDYTFINSIN 241 +++R+ +IAAE +GVN K K+ AF ++G+L + ++G+V V + + S Sbjct: 213 MAIRDMDIAAEIIGVNPLKAKLSAFGVSGFFIGVSGALFFSVYLGAVEVGEAFGINKSFL 272 Query: 242 VLIIVVFGGLGSITGAIVSAIVLGILNMLLQ------------DVASVRMIIYALALVLV 289 VL +V+ GGLGSI G+ A L +L ++L+ VA ++++I +V+ Sbjct: 273 VLFMVIIGGLGSIFGSFAGAAFLVLLPVVLKVVGVDVLGWPTDIVAHIQLVIVGALIVIF 332 Query: 290 MIFRPGGLLGTWELS 304 +I P G+ W ++ Sbjct: 333 LIAEPHGIAQLWRVA 347 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 358 Length adjustment: 28 Effective length of query: 290 Effective length of database: 330 Effective search space: 95700 Effective search space used: 95700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory