Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate GFF1712 PGA1_c17360 3-hydroxyisobutyrate dehydrogenase MmsB
Query= reanno::pseudo3_N2E3:AO353_05985 (294 letters) >FitnessBrowser__Phaeo:GFF1712 Length = 291 Score = 258 bits (658), Expect = 1e-73 Identities = 140/289 (48%), Positives = 181/289 (62%), Gaps = 9/289 (3%) Query: 1 MKIAFIGLGNMGAPMARNLIKAGHSLNLVDLNKAVLAELAQLGGTISATAREAAQGAELV 60 M I FIGLGNMG PMA NL KAGH + D+ A+++ G T++A+A EAA AE+V Sbjct: 1 MNIGFIGLGNMGGPMAANLAKAGHDVTGFDM-----ADVSIEGVTMAASAAEAATDAEVV 55 Query: 61 ITMLPAAVHVRSVWLGEDGVLAGIAKGVPAVDCSTIDPQTARDVAAAAAKQGVAMADAPV 120 ITMLP +R+V D V+ ++ G VDCST+D +AR VA A + DAPV Sbjct: 56 ITMLPNGQILRAV---ADDVIPAMSAGATLVDCSTVDVDSARAVADQAGSANLMFVDAPV 112 Query: 121 SGGTGGAAAGTLTFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLAIS 180 SGG GGA+ GTLTFM G + FA +P+ MG+ VHCGE G GQ AKICNN++L I+ Sbjct: 113 SGGIGGASGGTLTFMAGGSAAAFAAAEPLFDIMGQKAVHCGEAGAGQAAKICNNMILGIT 172 Query: 181 MVGVSEAMALGDALGIDTQVLAGIINSSTGRCWSSEMYNPWPGIVETAPASRGYTGGFGA 240 M+G EA AL D LG+D Q + ++++S+G WS Y P PG+ +PA Y GF A Sbjct: 173 MIGTCEAFALADKLGLDRQKMFDVVSTSSGYSWSMNAYCPAPGVGPQSPADNDYQPGFAA 232 Query: 241 ELMLKDLGLATEAARQAHQPVMLGAVAQQLYQA-MSQRGEGGKDFSAII 288 ELMLKDL LA +AA A +GA+AQ LY + G GKDFSA++ Sbjct: 233 ELMLKDLRLAQQAAHSADADTPMGALAQALYSMFVEDEGGAGKDFSAML 281 Lambda K H 0.317 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 291 Length adjustment: 26 Effective length of query: 268 Effective length of database: 265 Effective search space: 71020 Effective search space used: 71020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate GFF1712 PGA1_c17360 (3-hydroxyisobutyrate dehydrogenase MmsB)
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.10028.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-120 386.0 15.1 7e-120 385.7 15.1 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1712 PGA1_c17360 3-hydroxyisobutyrate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1712 PGA1_c17360 3-hydroxyisobutyrate dehydrogenase MmsB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 385.7 15.1 7e-120 7e-120 1 284 [. 5 281 .. 5 284 .. 0.98 Alignments for each domain: == domain 1 score: 385.7 bits; conditional E-value: 7e-120 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhvesvyagdegi 76 fiGlGnmGgpmaanl+kagh v+ fd+ + +G+++aasaaea+++a+vvitmlP g+ ++v +++ lcl|FitnessBrowser__Phaeo:GFF1712 5 FIGLGNMGGPMAANLAKAGHDVTGFDMADVSI-----EGVTMAASAAEAATDAEVVITMLPNGQILRAVA---DDV 72 9*************************986655.....6999************************99997...9** PP TIGR01692 77 lakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgeaeefaraepvleamgkn 152 ++ ++ ++ l+d+st+dvdsar+va++a ++ ++f+daPvsGG+gga Gtltfm+Gg+a++fa+aep+++ mg++ lcl|FitnessBrowser__Phaeo:GFF1712 73 IPAMSAGATLVDCSTVDVDSARAVADQAGSANLMFVDAPVSGGIGGASGGTLTFMAGGSAAAFAAAEPLFDIMGQK 148 **************************************************************************** PP TIGR01692 153 ivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilskssGrcWsldtynPvPGvveqaPasn 228 vh+G+aGaGqaakiCnn++lgi+miG++ea+al+ klGld + +++++s+ssG +Ws+++y+P PGv +q+Pa+n lcl|FitnessBrowser__Phaeo:GFF1712 149 AVHCGEAGAGQAAKICNNMILGITMIGTCEAFALADKLGLDRQKMFDVVSTSSGYSWSMNAYCPAPGVGPQSPADN 224 **************************************************************************** PP TIGR01692 229 gykgGfatalmlkdlglaqeaaksvkasvllGalarelyslfa.skgagkkdfsavi 284 +y++Gfa++lmlkdl+laq+aa+s+ a++++Gala++lys+f ++g +kdfsa++ lcl|FitnessBrowser__Phaeo:GFF1712 225 DYQPGFAAELMLKDLRLAQQAAHSADADTPMGALAQALYSMFVeDEGGAGKDFSAML 281 *****************************************98689999*****985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.50 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory