Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate GFF703 PGA1_c07180 2-hydroxy-3-oxopropionate reductase-like protein
Query= reanno::psRCH2:GFF2390 (296 letters) >FitnessBrowser__Phaeo:GFF703 Length = 321 Score = 126 bits (317), Expect = 6e-34 Identities = 86/273 (31%), Positives = 132/273 (48%), Gaps = 11/273 (4%) Query: 1 MHIGFIGLGNMGAPMAHNLLKAGHQLSVFDLNAAAVENLVGAGALPVDSPTAIAQGNAEL 60 M +GFIGLGN+G ++ +LL+ G LSV+DLN A V GA + P + + N + Sbjct: 1 MKVGFIGLGNVGGKLSGSLLRNGIDLSVYDLNEALVAKAAEVGATAANDPAELMR-NCDA 59 Query: 61 IITMLPAAAHVKGVYLGVNGLIAHSRAGVMLIDCSTIDPHSAREVAKAAAEHGNPMLDAP 120 +IT LP+ A V + ++ G + ++ ST D + + + G +D P Sbjct: 60 VITCLPSPAASDQV---MQQMLPEIGPGKIWMEMSTTDEAEVKRLGAMVEQAGGTAVDCP 116 Query: 121 VSGGTGGAAAGTLTFMVGGSDPDFDHAQPILAAMGKNIVHCGAAGNGQVAKVANNMLLGI 180 VSGG A G ++ G FD P+L MG+ I+H G G+ V KV N L Sbjct: 117 VSGGCHRADTGNISIFAGCDRETFDRIAPLLKTMGRRILHTGPIGSASVLKVITNYLATA 176 Query: 181 SMIGVAEAMALGVALGMDAKTLAGVINTSSGRCWSSDTYNPFPGVLDNVPSSRGYSGGFG 240 +++ EA+ A GMD T I SSG + +T + V+ N SR S F Sbjct: 177 NLLTCCEALVTAKAAGMDLNTAYEAIKISSGTSFVHETESQ---VILN--GSRDIS--FT 229 Query: 241 SDLMLKDLGLATEAAKQVRQPVILGALAQQLYQ 273 DL+ KD+GL A + P+ + L ++++ Sbjct: 230 MDLVSKDIGLFQAVADRHNVPLEINPLMIKIFK 262 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 321 Length adjustment: 27 Effective length of query: 269 Effective length of database: 294 Effective search space: 79086 Effective search space used: 79086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory