Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate GFF508 PGA1_c05200 putative ABC transporter, inner membrane component
Query= reanno::Dino:3607126 (288 letters) >FitnessBrowser__Phaeo:GFF508 Length = 287 Score = 130 bits (328), Expect = 3e-35 Identities = 75/239 (31%), Positives = 126/239 (52%), Gaps = 5/239 (2%) Query: 52 GLENYWTVLTDEVFWQAMGRTFFLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLV 111 GL+ + +L + F A+GR F L ++I LG+ IAL + + G + L ++L Sbjct: 48 GLDWFQQILRSDRFHAALGRQFMFTFLILIIEIPLGIAIALSMPRKGFWVPVCLVLMAL- 106 Query: 112 LPMATTYAVVGLLGQVMFNQKFGVVNQLLG---GADINWIGDPENAFAMIIFWDVWQWTP 168 PM + VVG + + G++ L G + + DP A+ II DVW WT Sbjct: 107 -PMLIPWNVVGAMWNIFTLPDIGLLGYFLNHTLGINYDMTQDPIAAWVTIITMDVWHWTS 165 Query: 169 FVALVLLAGLTMVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFD 228 V L+ AGL +P +AA+++ S W V R++QLP + L ++LR D+ ++ Sbjct: 166 LVVLLSYAGLVSIPDAYYQAAKIDGASNWAVFRFIQLPKMKTVLTIAILLRFMDSFNIYT 225 Query: 229 MVFTLTRGGPGSSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIVLAQIYIRVFYKE 287 F LT GGPG+ST +S+ + ++ FD G A+A ++I IT++++ ++ V K+ Sbjct: 226 EPFVLTGGGPGNSTTLLSIDLVKIALGQFDLGPAAAMSLIYFAITLLVSWLFYTVMTKD 284 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 287 Length adjustment: 26 Effective length of query: 262 Effective length of database: 261 Effective search space: 68382 Effective search space used: 68382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory